110,450 Free Images of C

cc-zerofiles uploaded by daderotcc-pd-markauthor died more than 100 years ago public domain imagesgoldvehiclemilitaryplantsaircraftnavy
Robert Peake the Elder - Portrait of Henry, Prince of Wales (c.1610)
prince of waleslondon
Alphabet
alphabetc
Unifraktur Maguntia Letter C
frakturfont
Dotted Capital C
typographyc
Stalk vegetables crop
vegetablesplants
Stalk vegetables crop
vegetablesplants
A U.S. Navy towed pinger locator and other ocean search and recovery assets sit in a cargo aircraft at John F. Kennedy International Airport in New York City March 24, 2014, before being transported to 140324-N-ZZ999-101
search for malaysia airlines flight 370march 2014 in new york city
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
naturespring
ROCAF C-130H 1309 and P-3C 3303 Display at Ching Chuang Kang Air Force Base Apron 20161126
militaryaircraft
Picture from book Indian Insect Life: a Manual of the Insects of the Plains by Harold Maxwell-Lefroy. Plate XXXIV - Syntomids and Noctuids Fig.1-Syntomis cyssea (=Amata cyssea (Stoll, 1782)) Fig.2-Sy
lepidopteragold
Dionysos and Ariadne. Detail of an Attic black-figure amphora, ca. 540 BC–530 BC. Français : Dionysos et Ariane. Détail d'une amphore attique à figures noires, v. 540–530 av. J.-C.
dionysos with sileni in ancient greek potteryancient greek neck amphoras
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
naturefood
US Navy 040901-C-4938N-085 A 25-foot Defender Class security boat attached to the Coast Guard Maritime Safety and Security Team 91106 sweeps the East River around Whitehall Terminal as the Staten Island Ferry arrives to Manhatt
vehiclewater
US Navy 070616-N-3038W-183 Sailors from Military Sealift Command fast combat support ship USNS Bridge (T-AOE 10) attach cargo nets holding pallets of supplies to an HH-60H Seahawk during a vertical replenishment
helihoisting of cargohh-60h rescue hawk
US Navy 051016-N-9500T-004 The U.S. Marine Corps C-130 Hercules, Fat Albert, assigned to the U.S. Navy Blue Angels flight demonstration team, uses Jet Assisted Take Off (JATO) bottles during the Marine Corps Air Station Miramar
militaryaircraft
US Navy 060506-N-3560G-035 Range Safety Coach Equipment Operator 2nd Class (SCW) Jose Amador of Naval Mobile Construction Battalion FOUR adjust the front sight of the M-16 service rifle during weapons qualifications at Marine C
militaryarmy
US Navy 070301-N-4420S-109 Aviation Boatswain's Mate (Handling) 3rd Class Baljeet Gill taxies an EA-6B Prowler assigned to the Black Ravens of Tactical Electronic Warfare Squadron (VAQ) 135 to the catapult aboard USS Nimi
grumman ea-6 prowler aircraft carrier launchesvehicle
US Navy 060831-N-3560G-051 Members of Naval Mobile Construction Battalion Four (NMCB-4) load Tricon Containers loaded with construction equipment destine for field testing in Iraq, into a U.S. Air Force, Air Mobility Command, C
militaryaircraft
US Navy 110909-N-OY799-228 An F-A-18C Hornet assigned to the Warhawks of Strike Fighter Squadron (VFA) 97 lands aboard the Nimitz-class aircraft ca
militaryvehicle
US Navy 100317-N-6538W-227 Aviation Structural Mechanic (Equipment) 3rd Class Rick Shammel, from Hartford, Conn., signals the shooter as an F-A-18F Super Hornet
lightnight
US Navy 100120-N-3589B-101 A flight deck director signals to an E2-C Hawkeye assigned to the Wallbangers of Carrier Airborne Early Warning Squadron (VAW) 117 during flight operations aboard the aircraft carrier USS Nimitz (CVN
militaryvehicle
US Navy 100727-N-2013O-063 Marine Corps C-130 Hercules leads a formation of F-A-18C Hornets and A-V-8B Harriers as they fly in formation over USS George Washington (CVN 73)
vehiclenavy
US Navy 080821-N-4163T-001 The crew of the aircraft carrier USS George Washington (CVN 73) mans the rails as the ship departs Naval Air Station North Island
vehicleship
US Navy 080807-N-4021H-087 The aircraft carrier USS Kitty Hawk (CV 63) returns to her homeport of San Diego after being forward deployed to Yokosuka, Japan for the past 10 years
vehicleboat
US Navy 070806-N-3038W-203 An MH-60S Seahawk attached to the Wild Cards of Helicopter Sea Combat Squadron (HSC) 23 transport supplies from the Military Sealift Command fast-combat support ship USNS Bridge (T-AOE 10)
militaryvehicle
US Navy 070809-N-2659P-040 Lt. Christopher Smith signals to Aviation Boatswain's Mate (Equipment) Airman James Christaudo before launching an E-2C Hawkeye assigned to Carrier Airborne Early Warning Squadron (VAW) 112
aboard uss john c. stennis (cvn-74)aviation boatswain's mate
US Navy 070204-N-0684R-046 A flight deck director signals the pilot of an E-2C Hawkeye assigned to the Golden Hawks of Carrier Airborne Early Warning Squadron One One Two (VAW-112) to spread his wings
militaryvehicle
Snack juice wood
backgroundvegetables
Crop plant winter onion
vegetablesplants
Citrus eat citrus fruits
winterfood
Kurprinz Friedrich Wilhelm (I) von Brandenburg-Prussia, wax model for medal by Raimund Falz, undated, perhaps c. 1696 - Bode-Museum - DSC02777
circlegold
Jules Peyron by Paul Cezanne, c. 1885-1887, oil on canvas - Fogg Art Museum, Harvard University - DSC01580
self-published workcc-pd-mark
Kalpis with four-horse chariot, attributed to the Rycroft Painter, c. 520 BC, terracotta - Middlebury College Museum of Art - Middlebury, VT - DSC07965
self-published workcc-pd-mark
Jacob Laying Peeled Rods before the Flocks of Laban, by Bartolome Esteban Murillo, Spanish, c. 1665, oil on canvas - Meadows Museum - Southern Methodist University - DSC05364
self-published workcc-pd-mark
Neck amphora with Herakles fighting the Nemean lion, attributed to Antimenes, Attic, c. 520 BC, L 185 - Martin von Wagner Museum - Würzburg, Germany - DSC05566
self-published workcc-pd-mark
Neck amphora with Europa on the bull, Attic, c. 510 BC, L 193 - Martin von Wagner Museum - Würzburg, Germany - DSC05598
self-published workcc-pd-mark
Neapolitan Fisherboy by Jean-Baptiste Carpeaux, 1857-c.1861, marble - National Gallery of Art, Washington - DSC08945
files with no machine-readable sourceself-published work
Neck amphora with Dionysos, Kleophrades Painter, Attic, c. 490 BC, L 222, cover L 278 - Martin von Wagner Museum - Würzburg, Germany - DSC05456
self-published workcc-pd-mark
Neck amphora with musician playing kithara and singing with dancer, Pan Painter, Greek, Attic, c. 465 BC, red-figure technique on earthenware - Krannert Art Museum, UIUC - DSC06533
self-published workcc-pd-mark
Mount Washington from Manns Hill (Littleton, NH), by Gamaliel W. Beaman, c. 1880, oil on canvas - Currier Museum of Art - Manchester, NH - DSC07448
landscapetree
Mount Washington from the Saco River, a Sketch, by Sanford Robinson Gifford, c. 1858, oil on paper mounted onto board - Chazen Museum of Art - DSC02152
self-published workadventure
Egyptian-revival lamp, c. 1805, porcelain, on pedestal after André-Charles Boulle, 1 of 2, 1800-1900, metal, pewter, wood - Saloon - Kingston Lacy - Dorset, England - DSC03500
interiorgold
Nike Pouring a Libation at an Altar, lekythos (oil flask), Berlin Painter, Greek, Attic, c. 490 BC, terracotta, red-figure technique - Arthur M. Sackler Museum, Harvard University - DSC01545
self-published workcc-pd-mark
Two Roundels with Scenes from the Life of Abraham, 1. Abraham sends his Servant to find a Wife for Isaac, Southern Netherlands, c. 1500, stained glass - Museum Schnütgen - Cologne, Germany - DSC09860
self-published workcc-pd-mark
Pelike with Boreas and Orithyia, attributed to the Niobid Painter, Attick, c. 460 BC, L 511 - Martin von Wagner Museum - Würzburg, Germany - DSC05796
self-published workpelikai
Plate with the arms of the Duke of Anhalt-Zerbst, China, Qing dynasty, Qianlong period, c. 1745, porcelain, polychrome enamel, gold - Montreal Museum of Fine Arts - Montreal, Canada - DSC09395
platebowl
OP Wickham 616 C Bluffs IA
self-published workpages with maps
Persona Fumando en la Avenida Paulista
peoplecity
Ruyi (wish granting scepter) used in Empress Xiaoding's wedding, Imperial Workshop, Beijing, China, Guangxu period, c. 1888-1889 AD, gold alloy, silk, coral, seed pearls - Peabody Essex Museum - DSC07847
self-published workberries
Still Life with a Boy Blowing Soap-bubbles by Gerard Dou, c. 1635-1636, oil on panel - National Museum of Western Art, Tokyo - DSC08420
self-published workcc-pd-mark
The artist carried in a sillero over the Chiapas from Palenque to Ocosingo, Mexico, by Johann Friedrich Waldeck, French, c. 1833, oil on wood panel - Princeton University Art Museum - DSC07048
self-published workcc-pd-mark
Shea 309 C Bluffs IA
self-published workvillage
Snowbound Stream by John Henry Twachtman, c. 1895, oil on canvas - New Britain Museum of American Art - DSC09530
self-published workcc-pd-mark
Turban snail cup and cover, probably German, c. 1600, stand by Johann Joachim Busch, German, Mecklenburg, before 1753, Turbo marmoratus shell, silver - Metropolitan Museum of Art - New York City - DSC06922
goldengold
Tale of Genji, Butterflies (Kocho), Tosa Mitsunobu painter, Reizei Tamehiro calligrapher, Japan, Muromachi period, c. 1509 AD, paper - Arthur M. Sackler Museum, Harvard University - DSC01142
self-published workcard
Tasso reading an episode from Jerusalem Delivered to Princess Eleanor, or Poetry, by Louis Ducis, France, c. 1819-1822, oil on canvas - Montreal Museum of Fine Arts - Montreal, Canada - DSC08698
self-published workcc-pd-mark
Plate with the arms of Lee of Coton quartered with Astley, China, Qing dynasty, Yongzheng period, c. 1730-1735, porcelain, polychrome enamel, gilt - Montreal Museum of Fine Arts - Montreal, Canada - DSC09377
platebowl
Epiphany, Jan Havicksz Steen, c. 1664, oil on canvas - Villa Vauban - Luxembourg City - DSC06630
self-published workcc-pd-mark
Belly amphora with Herakles and the Nemean lion, Attic, c. 540 BC, L 263 - Martin von Wagner Museum - Würzburg, Germany - DSC05537
self-published workcc-pd-mark
Honore-Gabriel Riqueti, Comte de Mirabeau, by the Duc d'Orleans factory after a model by Claude-Andre Deseine, Paris, France, c. 1791-1792, hard-paste porcelain- Museum of Fine Arts, Boston - 20180922 151345
self-published workcc-pd-mark
Cylindrical vessel with ballgame scene, Maya, Ik' Emblem Glyph site, Motul de San Jose area, El Peten area, Guatemala, Late Classic period, c. 700-850 AD, ceramic - Dallas Museum of Art - DSC04634
self-published workcc-pd-mark
Court lady, funerary statuette, North Central China, Tang dynasty, c. 675-725, slip-painted earthenware, traces of pigment - Montreal Museum of Fine Arts - Montreal, Canada - DSC09635
self-published workgold
Clock by Jean-Nicolas Schmit, Paris, with bisque porcelain figures from the Duc d’Angoulême’s porcelain factory, c. 1785-1790 - Waddesdon Manor - Buckinghamshire, England - DSC07789
self-published workcc-pd-mark
Bahram Chubina in combat with Saveh, folio from Shanameh, signed Mu'in (Musavvir), Iran, Isfahan, c. 1666-1667 AD, watercolour, ink, and gold on paper - Aga Khan Museum - Toronto, Canada - DSC06943
self-published workcc-pd-mark
Arthur C. and Mary S.A. Nash House 1
architecturetown
Santa Justa by Bartolome Esteban Murillo, Spanish, c. 1665, oil on canvas - Meadows Museum - Southern Methodist University (retouched)
self-published workderivative versions
Chest of drawers, Joseph Clark (1767-1851), Greenland NH, c. 1813, mahogany, birch, white pine, with mahogany, birch, white pine veneers - Currier Museum of Art - Manchester, NH - DSC07673
self-published workindoor
Two windows from the suite Four Seasons Under the Sea, 1 of 2, Starfish (Spring), Louis Comfort Tiffany designer, Tiffany Glass and Decorating Co., c. 1885-1895, glass, lead - Dallas Museum of Art - DSC05177
colorblue
Stalk vegetables crop
vegetablesplants
Plantation orangengargen orange baumgarten
foodtree
Plant blue food
berriesfood
Auto elegant novelty
vehiclemetal
Granville Leveson-Gower, Marquis of Stafford, modeling attributed to William Hackwood, c. 1782, green jasper, white relief - Wedgwood Museum - Barlaston, Stoke-on-Trent, England - DSC09560
self-published workcc-pd-mark
Fish plate, Greece, Apulian red figure, c. 350-325 BC, terracotta - Spurlock Museum, UIUC - DSC05801
circlegold
Saint George and the Dragon, Kreuzherrenkloster Schwarzenbroich bei Langerwehe - Kreis Düren, Köln, c. 1450 AD, stained and painted glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00606
self-published workcc-pd-mark
Saint Luke Painting the Virgin and Child, Master of the Holy Blood, Netherlandish, c. 1520, oil on oak panel - Fogg Art Museum, Harvard University - DSC01020
self-published workcc-pd-mark
Saint Catherine by Peter Hemmel von Andlau, view 1, Upper Rhine, c. 1480 AD, stained and painted glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00409
self-published workcolor
Mount Washington from Lake Sebago, Maine, by Jasper Francis Cropsey, c. 1867, oil on canvas - Currier Museum of Art - Manchester, NH - DSC07520
watertree
Mother of God enthroned, by Peter Hemmel von Andlau, view 3, from the Nonnberg monastery in Salzburg, Upper Rhine, c. 1480, stained glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00423
stift nonnbergarchitecture
Mother of God enthroned, by Peter Hemmel von Andlau, view 2, from the Nonnberg monastery in Salzburg, Upper Rhine, c. 1480, stained glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00421
stift nonnbergarchitecture
Mother of God and Saint George, from St. Nazarius and Celsus in Ersheim-Neckar, Upper Rhine, c. 1517 AD, stained and painted glass - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00626
self-published workarchitecture
Model tray for making chicha (corn beer), Peru, Chancay-Chimu, north central coast, c. 1400 AD, silvered copper - Krannert Art Museum, UIUC - DSC06441
self-published workcc-pd-mark
Lidded effigy container in the form of a diving god, Maya, Northern Belize or Quintana Roo, Mexico, c. 1500 AD, ceramic, post-fire polychrome paint - Princeton University Art Museum - DSC07161
self-published workcc-pd-mark
Madonna triptych (Madonna and Child with Saints and Angels), by Giovanni del Biondo, c. 1380-1390, tempera on panel - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00561
self-published workgold
Mantel from the Nathan Read house, carving by Samuel McIntire, c. 1800, with View of Court House Square, Salem, by George Washington Felt, 1810-1820, oil on wood panel - Peabody Essex Museum - DSC07133
interior designgold
The Former Deeds of King Wondrous Splendor, Chapter 27 of the Lotus Sutra, Tosa Mitsuoki, Japan, Edo period, c. 1667 AD, gold, silver, indigo-dyed paper - Arthur M. Sackler Museum, Harvard University - DSC01147
self-published workgold
The Former Deeds of Bodhisattva Medicine King, Chapter 23 of the Lotus Sutra, Japan, Heian period, c. 1150 AD, ink, color, silver, gold, dyed paper - Arthur M. Sackler Museum, Harvard University - DSC01154
self-published workcc-pd-mark
Stamnos with chariot races, Perizoma Group (Michigan Painter), Attic, c. 510 BC, L 327 - Martin von Wagner Museum - Würzburg, Germany - DSC05507
self-published workcc-pd-mark
Portrait of Cardinal Domenico Rivarola, by Sir Anthony van Dyck, c. 1623-1624, oil on canvas - Portland Art Museum - Portland, Oregon - DSC09053
self-published workcc-pd-mark
Epiphany (detail), Jan Havicksz Steen, c. 1664, oil on canvas - Villa Vauban - Luxembourg City - DSC06636
self-published workcc-pd-mark
Richard Grenville, 2nd Earl Temple, by Robert Edge Pince, c. 1776, oil on canvas - Stowe House - Buckinghamshire, England - DSC07107
self-published workcc-pd-mark
Virgin and Child, by Andrea della Robbia, c. 1490, glazed terracotta on a painted and gilded frame - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00572
self-published workcc-pd-mark
Venice, Piazza San Marco towards the Basilica of San Marco, by Luca Carlevaris, Italian, c. 1725, oil on canvas - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00809
self-published workarchitecture
Toilet service, Charles Gouyn designer, St. James's Factory, London, England, c. 1755, gold-mounted porcelain with enamel decoration, gold, steel, glass, paper - Dallas Museum of Art - DSC05158
toilet servicegold
PS 109 rehab 215 E. 99th St jeh
self-published workeast harlem
Reliquary phylactery with a finger of Marie d'Oignes, by Hugo de Walcourt workshop, c. 1230 AD, wood, gilt copper, enamel, semi-precious stones - Cinquantenaire Museum - Brussels, Belgium - DSC08837
self-published workgold
Cabinet commissioned by William Beckford, designer Jean-Guillaume Moitte, Adam Weisweiler maker, Henri August bronze, Paris, c. 1792, Japanese lacquer, mahogany- Museum of Fine Arts, Boston - 20180922 151722
self-published workindoor
KC-135F refueling Mirage 2000 and F-18C 1994
militaryvehicle
Large famille verte dish, China, Jingdezhen, Qing dynasty, Kangxi period, c. 1700-1720, porcelain, polychrome enamel - Montreal Museum of Fine Arts - Montreal, Canada - DSC09405
platefood
Welcoming the Strangers, from the Seven Acts of Mercy, by Sebastien Bourdon, c. 1665, oil on canvas - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00616
self-published workcc-pd-mark
29301 - 29400 of 110,450 Next page
/ 1105