110,450 Free Images of C

cc-zerocc-pd-markfiles uploaded by daderotauthor died more than 100 years ago public domain imagesvehicleplantsmilitaryaircraftjetauthor died more than 70 years ago public domain images
Three-handled trophy cup with images of Payson Tucker and Portland's Union Station, Tiffany and Company, c. 1896, silver, gilt interior, view 2 - Portland Museum of Art - Portland, Maine - DSC04077
self-published workcc-pd-mark
Statuette of a Striding Man, Egypt, Old Kingdom, Dynasty 6, probably reign of Pepi II, c. 2246-2152 BC, wood - Arthur M. Sackler Museum, Harvard University - DSC01468
self-published workcc-pd-mark
Stela of the mayor Ituerneheh, Egypt, possibly from Naga-ed-Deir, First Intermediate Period, c. 210-2040 BC, painted limestone - Harvard Semitic Museum - Cambridge, MA - DSC06206
self-published workcc-pd-mark
The Dance of Salome, by Matteo di Giovanni, c. 1480, tempera and gold leaf on panel - Hyde Collection - Glens Falls, NY - 20180224 122824
self-published workcc-pd-mark
The Wife of Hasdrubal and Her Children, Ercole de' Roberti, c. 1490-1493, tempera on panel - National Gallery of Art, Washington - DSC08828
self-published workcc-pd-mark
Tile with hieroglyphic inscription, Luxor, Medinet Habu, New Kingdom, Dynasty 20, reign of Ramesses III, c. 1182-1151 BC, faience, glaze, glass - Oriental Institute Museum, University of Chicago - DSC07921
self-published workcard
Nautilus Centerpiece, designed by William C. Codman, Gorham Manufacturing Co., Providence, Rhode Island, 1893, gilt silver, pearls, turquoise, jade, garnet, tourmaline, etc - Dallas Museum of Art - DSC04879
self-published workgold
Oinochoe with Dionysos and panther, Attic, c. 510 BC, L 344 - Martin von Wagner Museum - Würzburg, Germany - DSC05558
self-published workcc-pd-mark
Oinochoe with three dancing men, Attic, c. 510 BC, L 344 - Martin von Wagner Museum - Würzburg, Germany - DSC05561
self-published workcc-pd-mark
Phaeton and Apollo, by Louis Laguerre, c. 1688-1693 - State Music Room, Chatsworth House - Derbyshire, England - DSC03202
self-published workcc-pd-mark
Parlor organ, Estey Organ Company, Brattleboro VT, c. 1882, walnut, pine, steel, painted and gilt with ivory and ebony keys - Bennington Museum - Bennington, VT - DSC09091
self-published workcc-pd-mark
Pair of coffee cup from Switzerland (probably Geneva) made for export to Turkey, c. 1830, enameled gold, porcelain
self-published workcoffee cup
Portrait of a Man, by Sebastiano Luciani, called Sebastiano del Piombo, Venice or Rome, c. 1516, oil on wood panel - Blanton Museum of Art - Austin, Texas - DSC07724
portraits by sebastiano del piomboself-published work
Portrait of King Henry VIII by Han Holbein the Younger, c. 1534-1536 AD, oil on wood - Museo Nacional Centro de Arte Reina Sofía - Madrid, Spain - DSC08570
self-published workcc-pd-mark
Prince Shotoku (574-622 AD) at Age Two, Japan, Kamakura period, c. 1292 AD, cypress, polychromy, rock-crystal inlaid eyes - Arthur M. Sackler Museum, Harvard University - DSC01169
self-published workcc-pd-mark
Kinrande-style tea bowl (chawan), attributed to Eiraku Hozen, Kyoto, Japan, c. 1830, porcelain, underglaze blue, red enamel, gilding - Montreal Museum of Fine Arts - Montreal, Canada - DSC09515
orangechawan
Kinrande-style tea bowl (chawan), attributed to Eiraku Hozen, Kyoto, Japan, c. 1830, porcelain, underglaze blue, red enamel, gilding - Montreal Museum of Fine Arts - Montreal, Canada - DSC09515A (retouched)
orangechawan
US Navy 070403-N-2659P-163 An Aircraft Launching Officer Shooter assigned to air department's launch and recover division, ducks after launching an S-3B Viking
militaryvehicle
US Navy 070406-N-2659P-154 A Sailor uses a pushback bar to assist with retracting the arresting gear wire after an F-A-18C Hornet, from the Blue Diamonds of Strike Fighter Squadron (VFA) 146, lands aboard Nimitz-class aircraft
f/a-18c hornet on flight decksarrestor cables
US Navy 070506-N-8157C-075 An HH-60H Seahawk, from the Eightballers of Helicopter Anti-Submarine Squadron (HS) 8, transfers stores and supplies from USNS Bridge (T-AOE 10)
sunsetsun
US Navy 070512-N-3038W-022 (left to right) Incoming Commanding Officer Cmdr. Larry Vincent and outgoing Commanding Officer Cmdr. Murray Tynch from the Eightballers of Helicopter Anti-Submarine Squadron (HS) 8 salute as Vincent
change of command ceremonies of the united states navygroup
US Navy 070521-N-2659P-010 Aviation Boatswain's Mate 2nd Class Cordon Minor, left, and Aviation Boatswain's Mate Airman Andrew Runge give thumbs up to the pilot of an F-A-18C
militaryvehicle
US Navy 080828-N-9076B-003 The aircraft carrier USS Kitty Hawk (CV 63) pulls away from the pier at Naval Air Station North Island Calif
vehicleboat
US Navy 071123-N-0684R-120 Final checkers give thumbs up signaling everything is safe just prior to an F-A-18F Super Hornet assigned to the Black Knights of Fighter Strike Squadron One Five Four (VFA-154) launching
militaryvehicle
US Navy 070624-N-0989H-079 Capt. Douglas Wied, commander, Task Group 40.9, gives Valm Julio Cesar Ventura Bayonet, Valm Ivam Pena Castillo of the Dominican Republic Navy a tour of High Speed Vessel (HSV) 2 Swift
dominican republic2007
US Navy 080619-N-2610F-179 An F-A-18C Hornet assigned to the
militaryvehicle
US Navy 080807-N-7883G-367 The aircraft carrier USS Kitty Hawk (CV 63) approaches the pier at Naval Air Station North Island for the first time in 10 years
vehicleboat
US Navy 061115-N-3285B-204 Consul General to the Netherlands Antilles Robert E. Sorenson speaks at a reception held aboard the Oliver Hazard Perry-class frigate USS Stephen W. Groves (FFG 29)
jon c. kreitzgroup
US Navy 050317-C-0000L-001 U.S. Coast Guard Petty Officer 1st Class Brian Laubenstein, a rescue swimmer assigned to Coast Guard Air Station Cape Cod, right, monitors an injured fisherman's vitals inside the cabin of an HH-60 Ja
patient transportrescue swimmer
US Navy 091211-N-9928E-152 An F-A-18C Hornet assigned to the Sharpshooters of Marine Fighter Attack Training Squadron (VMFAT) 101 lands on the flight deck
militaryvehicle
US Navy 090304-N-8933S-037 Special Warfare Combatant-craft Crewmen (SWCC) assigned to Special Boat Team (SBT) 22 conduct live-fire drills at the riverine training range at John C. Stennis Space Center
vehicletree
US Navy 070706-A-4074M-007 Capt. Bruce C. Meneley, center, relieves Capt. Ronald L. Sollock, left, as commander of U.S. Naval Hospital and Joint Task Force (JTF) Guantanamo Bay Joint Medical Group during a change of command cer
people of the united states navyguantanamo
US Navy 091106-N-5538K-223 Aviation Boatswain's Mate (Handling) Airman Derek C. Townsend and Aviation Support Equipment Technician Airman Apprentice Quatin F. Robinson run clear OF an MH-60S Sea Hawk helicopter
aviation support equipment technicianaviation boatswain's mate
US Navy 070123-N-3729H-136 An EA-6B Prowler assigned to the Yellowjackets of Tactical Electronic Warfare Squadron One Three Eight (VAQ-138) takes off from the flight deck as Aviation Boatswains Mate 2nd Class Montego Kornegay p
militaryvehicle
US Navy 030828-C-5313L-543 U.S. Coast Guard Cutter Bainbridge Island (WPB 1343), home ported in Sandy Hook, NJ., stands watch over the Statue of Liberty in New York Harbor
waterboat
Madonna and Child with a Donor, by Andrea Previtali, Italy, c. 1504-1505, tempera and oil on panel - Wadsworth Atheneum - Hartford, CT - DSC05023
16th-century oil on panel paintings in the united states16th-century religious paintings in the united states
Defense.gov News Photo 111221-N-OY799-360 - An MH-60S Sea Hawk helicopter from Sea Combat Squadron 8 picks up stores from the flight deck of the Military Sealift Command fast combat support
vehiclenavy
Crew of the NC-4 in Navy Cross award ceremony
monochromepeople
Roundel with the head of a nobleman, India, Mathura, Uttar Pradesh, c. 1st-2nd century CE, pink sandstone, HAA
1st-century reliefs in the united statesself-published work
ROCAF C-130H 1318 Taxiing at Ching Chuang Kang Air Force Base 20140719c
militaryvehicle
Sand-Strohblume (Helichrysum arenarium) im Naturschutzgebiet Hirschacker und Dossenwald
plantsgrow
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
natureplants
Close-ups of a) Salvia, Family Lamiaceae Salvia Salvia splendens F. Sellow ex R. & S. Scarlet Sage Xiang ya hong, b) Dwarf Sunflowers, c) Aster (genus) d) Dwarf Zinia in Barangays Pagala, 14°58'14
plantsflower
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
landscapesummer
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
landscapegrass
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
springplants
Melon Sweet Flavor plantations in Candaba, Pampanga Cucumis melo cantaloupe group fields in the Philippines Known-You Seed Co., LTD. Known-You Seed Co., LTD., Zhuliao Road, Dashu District, Kaohsiung C
plantsfood
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
naturebird
Holy Family by Mattia Preti, c. 1653, oil on canvas - Blanton Museum of Art - Austin, Texas - DSC07943
self-published workcc-pd-mark
Plate with the arms of Goodwin of Devon and Suffolk, China, Qing dynasty, Yongzheng period, c. 1730, porcelain, polychrome enamel, gold - Montreal Museum of Fine Arts - Montreal, Canada - DSC09383
self-published workcircle
Mug with the arms of Sir John Lambert, China, Qing dynasty, Yongzheng period, c. 1722, porcelain, rouge-de-fer, polychrome enamel, gold - Montreal Museum of Fine Arts - Montreal, Canada - DSC09389
self-published workcc-pd-mark
Self-portrait of Gerard Dou (1613-1675), Gerrit Dou, 1665
dutch golden age painting,fijnschilderpaintings by gerard dou with fur
Giovan Battista Moroni, Portrait of a child of the House of Redetti c. 1570. Accademia Carrara, Bergamo
portraits by giovanni battista moroniblack and gold clothing
Henry, Prince of Wales by Isaac Oliver, c. 1610-12
prince of walesisaac oliver
James Wolfe by J.S.C. Schaak
facing leftlondon
Titian (c.1488-1576) - Portrait of an Unknown Man (once called 'Pietro Aretino') - 851770 - National Trust
16th-century portrait paintings of men with presumed sitter1510s portrait paintings from italy
Raphael West and Benjamin West Jr., Sons of the Artist, by Benjamin West, c. 1796 - Nelson-Atkins Museum of Art - DSC09044
18th-century oil portraits of men at half length18th-century family portraits
M. B. Baer - Teribilul complotŭ dela Jilava (Fabula epurească). Cataţĭ bine acĭ trebue să fie bombele şi carabinele, uitele păziţivĕ bine să căutăm bine şi corespondinţa cu Mazini şi Rosetĭ, Ghimpele, 6 sept 1870
anthropomorphic rabbits and haresilfov
Queen Charlotte - After Zoffany c. 1775
portrait paintings of women with hair with pearl jewellery18th-century oil portraits of women at bust length
Amigoni, Jacopo - Venus and Adonis - c. 1740
18th-century paintings of people with dogssighthounds in art
'The Release of St. Peter', oil on canvas painting by Bernardo Strozzi, c. 1635, Art Gallery of New South Wales
17th-century paintings of angels on the ground with humanssaint peter
Gouache on parchment equeatrian portrait of Dauphin Henry II by François Clouet, c. 1543, Menil Collection
16th-century portrait paintings in the united states16th-century equestrian portraits of men
Michael Sweerts - self portrait with a skull c.1660
17th-century three-quarter view portrait paintings of menmichiel sweerts
Lafosse, Charles de - Sunrise with the Chariot of Apollo - c. 1672
paintings of putti in franceround paintings
Berentz, Christian - Still-Life - 17th or 18th c
blue and white porcelainoil still-life paintings
Cape St Vincent, 1797 RCIN 735048.c
17871781
Not like the same old Capitol by Homer Davenport
people at windows in artsitting men in art
Frans Snyders - Van Dyck c. 1620
17th-century portrait paintings in the united statesmale
Portrait of a Young Man, c. 1535-40, Hans Holbein the Younger
round portraits of menfacing right
Hans Schäufelein - Bildnis eines Mannes (c.1507)
16th-century oil portraits of men at bust lengthmale fur clothing in art
Vignon, Claude - Portrait of François Langlois - c. 1621
bagpipers in artclaude vignon
Lambert Sustris - 'The Education of Cupid', oil on canvas painting attributed to, c. 1540, El Paso Museum of Art
1540s paintings from italywinged petasos in art
Leighton-The Fisherman and the Syren-c. 1856-1858
frederic leightonmermaid
Anna Leopoldovna by L.Caravaque (c.1740, Russian museum)
ermine (clothing) in artfur capes in art
Csontváry, self-portrait, c 1896
19th-century self-portrait paintings of menmen facing right in art
Frans Hals 095 WGA version
17th-century portrait paintings in the united states1974
François Clouet (c. 1520-1572) - Hercule-François, Duke of Alençon and of Anjou (1555-84) - RCIN 403434 - Royal Collection
portrait paintings of males in the royal collection of the united kingdomfrançois
British Mycological Society 1918 (1), Gulielma Lister, 14 September 1918
jessie sproat bayliss-elliottbritish mycological society
British Mycological Society 1918 (2), Gulielma Lister, 14 September 1918
jessie sproat bayliss-elliottbritish mycological society
Hedwig Eleanor of Sweden c 1666 by David Klöcker Ehrenstrahl (crop)
17th-century portrait paintings in the skokloster castledraped columns on pedestals in portrait paintings
William Hogarth, Self-portrait (c. 1735, Yale Center for British Art)
18th-century oil portraits of men at bust lengthmale
Charles Brandon (c 1485-1546) by Master of the Brandon Portrait
16th-century oil portraits of men at half lengthmale fur clothing in art
Hans Krell - Portrait of King Louis II of Hungary (c.1522)
portrait paintings of men wearing black beretsportraits with latin captions
La baigneuse endormie (1897) par Auguste Renoir (A)
works by pierre-auguste renoir by fezzi numberarmpits of topless females in art
Renoir sleeping-woman-1897
works by pierre-auguste renoir by fezzi numberarmpits of topless females in art
'Portrait of a Boy', watercolor on ivory portrait miniature by James Nixon, c. 1810-1820, Museum of Fine Arts, Houston
19th-century portrait paintings in the united stateshouston
Csontváry, self-portrait with frame, c 1896
19th-century self-portrait paintings of menmen facing right in art
'Allegory of Spring', oil on canvas painting by Jan Breughel II and an unknown figure painter in the style of Hendrik van Balen, c. 1620s
paintings of people in nature1620s paintings of flowers
DBviger, Johan Coenraad Hamburger
denis-benjamin vigerthéophile hamel
Vecelli, Tiziano - Judith - c. 1515
16th-century religious paintings in italysalome
Meister des Aachener Altares — Hans von Melem — c. 1480 - 1520
portraits with latin captionsmale fur clothing in art
'Mars Vigilant' by Jan van Bijlert, c. 1630, Norton Simon Museum
17th-century oil portraits of men at half length in armour17th-century portrait paintings in the united states
Thomas Anson (c. 1695 – 30 March 1773)
paintings in shugborough hallmale
François de Troy, Portrait of Princess Louisa Maria Stuart (c. 1705)
françois de troyfemale
RusPortraits v2-060 Elisabeth Alexandrowna Tchernycheff
female hair fashion in artframe painting
Louis Tocqué, c.1745, Portrait of Frederik Berregaard
1740s portrait paintings from francefacing right and looking at viewer
'Venus and Cupid', oil on canvas painting by Battista Dossi (Battista de' Luteri), c. 1540, Philadelphia Museum of Art
paintings of venus and cupid1540s paintings from italy
Kaiser Karl VI by Martin van Meytens the Younger, c. 1735 AD, oil on canvas - Braunschweigisches Landesmuseum - DSC04617
paintings in the braunschweigisches landesmuseumholy roman emperor
Thomas Audley (c.1488–1544), Lord Audley, 1569
marten (clothing) in artfur pieces
S.S.Yakovlev by Borovikovsky (c.1816, Louvre)
draped columns on pedestals in portrait paintingsred drapery in portrait paintings
29201 - 29300 of 110,450 Next page
/ 1105