94,982 Free Photos of Navy

images from united states navy to checkvehicleaircraftmilitarygroupaviationflyjetshipflight
US Navy 090608-N-3271W-080 Chief Warrant Officer Tim Andros and Navy Diver 1st Class Chris Staten, both assigned to Mobile Diving and Salvage Unit (MDSU) 2 based in Little Creek, Va., show some of their diving equipment to Tenn
tennessee aquariumpeople
US Navy 090824-N-9689V-005 Mission chaplain Lt. Todd Delaney, presents representatives from the Red Cross and the Kiribati Association of Non-Governmental Organizations, with donations on behalf of Project Handclasp
united states navy images from kiribatitarawa atoll
US Navy 090902-N-2888Q-003 Petty Officer 3rd Class Debby Warden, from Navy Operation Support Center Columbus, and Sgt. Matthew Smith, from Navy Recruiting District Ohio, clean the rain gutters on a home as part of a Rebuilding
building maintenanceohio
US Navy 091015-N-6692A-092 Chief Master-at-Arms Randy Bell, Senior Chief Culinary Specialist Albert Puyot and a sailor from the Philippines navy pour a new concrete walkway during a Amphibious Landing Exercise (PHIBLEX) 2009 co
culinary specialist (united states navy)master-at-arms
US Navy 080923-N-7544A-274 Lt. Pandora Liptrot, a Navy Nurse Corps officer embarked aboard the amphibious assault ship USS Kearsarge (LHD 3) gives deworming medication to a child at the Center of the Grace of Good Samaritan Orp
navy nurse corps (united states)antihelmintics
US Navy 080729-N-7095C-001 Capt. Kevin M. O'Day inspects the cutter's crew during a change of command ceremony in Singapore
singaporegroup
US Navy 081010-N-0411D-051 Construction Electrician 1st Class Sean Dement, left, Senior Chief Equipment Operator George Waldrop, and Information Technology Specialist Jamie Marshall plot a map point during a Navy Expeditionary
nightdark
US Navy 070529-N-0989H-018 Members from the U.S. Navy Expeditionary Training Command and U.S. Coast Guard International Training Division demonstrate proper vessel towing procedures to Honduran navy, marine force and port autho
united states navy images from puerto castillahonduras
US Navy 070402-N-8704K-012 The Navy Show Band poses for a photo aboard the 17th century sail ship Godspeed, a replica of one of four ships that brought English Colonists to Virginia in 1607
vehiclewater
US Navy 110723-N-YB753-069 An F-A-18F Super Hornet assigned to the Bounty Hunters of Strike Fighter Squadron (VFA) 2 launches from the aircraft car
vehiclenavy
US Navy 110810-N-BT887-152 Aviation Structural Mechanic 3rd Class Sean Vasquez performs a pre-flight check on the wing of an F-A-18F Super Hornet a
vehiclenavy
US Navy 110513-N-XR557-166 Lt. Nels Peterson, future operations officer of Riverine Squadron (RIVRON) 1, explains the capabilities of the Aqua Puma
militaryarmy
Ship Watercraft Sea Submarine Chaser
vehiclewater
Air Fighters Show
militaryvehicle
Air Fighter Upward
militaryvehicle
Assembling Structures In The Payload Bay
vehicleboat
Three Air Fighters
militaryvehicle
Sky, Skis, Plane
militaryaircraft
Grey, Metal, Lelystad airport
aircraftvehicle
John wayne airport, United states, Flying
planefly
US Navy 100312-N-7948C-033 Italian navy Lt. Cmdr. Marco Compasso, assigned to Africa Partnership Station (APS) West staff, speaks with a Ghanaian Sailor during a maritime domain awareness workshop aboard the amphibious dock lan
united states navy in sekondi-takoradiaboard uss gunston hall (lsd-44)
US Navy 100523-N-0413B-201 Navy Diver 2nd Class James Maxey, left, and Navy Diver 2nd Class Dicky Ellis, both assigned to Mobile Diving Salvage Unit (MDSU) 1, conduct post dive maintenance on a MK-3 diving helmet
joint pow/mia accounting commandunited states navy divers
US Navy 110922-N-RI844-133 A Bangladesh navy sailor fires a Type-56 assault rifle aboard the Bangladesh navy frigate BNS Bangabandhu (F 25) during
military2001
US Navy 081117-N-3610L-205 Quartermaster 3rd Class Desiree Semma uses a sound-powered phone to relay messages and update a plotting change
united states navy images from honoluluwomen in the united states navy
US Navy 100810-N-9818V-019 The U.S. Navy Ceremonial Guard presents the colors at the Armed Forces Retirement Home during a dedication ceremony for an anchor
washingtonarmy
Anne M. Swap (2)
official portrait photographs of rear admirals (lower half) of the united states navymilitary people with the national flag of the united states in background
Flickr - Official U.S. Navy Imagery - Aviation Ordnanceman 3rd Class Daniel Coggins and Aviation Ordnanceman Airman Eric Fernandez clear the area for an MH-60S Sea Hawk helicopter.
militaryaircraft
US Navy 061030-N-8148A-072 U.S. Navy Sailors Assigned to the harbor patrol boat unit from Naval Security Force Bahrain, monitor merchant ship traffic off the coast
vehiclewater
US Navy 071021-N-2653P-241 A member of the Navy Ceremonial Guard escorts Daniel and Maureen Murphy, the parents of Navy SEAL Lt. Michael Murphy, through Arlington National Cemetery
memorial wreathsdan murphy
US Navy 071023-N-5319A-011 Daniel and Maureen Murphy, seated center, the parents of Navy SEAL Lt. Michael Murphy, attend their son's Medal of Honor Flag ceremony held at the United States Navy Memorial
sitting peoplegroup
US Navy 101001-N-8273J-171 Chief of Naval Operations (CNO) Adm. Gary Roughead, right, and Vice Adm. Russ Crane, left, Chief of Navy of the Royal Au
clearance diving branch (ran)gary roughead in 2010
US Navy 060815-N-9851B-003 A Philippine Navy color guard parades the colors for the opening ceremony for the sixth phase of Cooperation Afloat Readiness and Training (CARAT)
united states navy images from subic baycolor guards of the united states navy
US Navy 060829-N-3714J-024 Navy Chaplain Cmdr. Donald Fix of Pittsburg, attached to the Medical Treatment Facility aboard the Military Sealift Command hospital ship USNS Mercy (T-AH 19), entertains patients
project hopegroup
US Navy 040717-F-6340W-319 A U.S. Navy SEAL (Sea, Air, Land) conceals himself under camouflage during a demonstration of seizing a beach
ghillie suitsvirginia
US Navy 031204-N-9693M-033 The Secretary of the Navy, the Honorable Gordon R. England tugs on Bill the U.S. Naval Academy mascot, as Midshipmen cheerleaders and band members conduct a Go Navy, Beat Army pep rally
groupd.c.,
US Navy 091113-N-0000X-048 Sailors from the Maritime Civil Affairs and Security Training Command's Security Force Assistance Detachment pose with officers from the Royal Cambodian Navy
royal cambodian navyarmy
US Navy 090220-N-4774B-064 The head of staff of the Kuda Kudhin ge Hiya neglected children's home in Villingili presents Chaplain Lt. j.g. Jarrod Johnson and Lt. j.g. Malcolm Lybeck with gifts
united states navy chaplainsgroup
US Navy 090603-N-8848T-021 Cmdr. Rhonda K. Harders, commanding officer of Naval Recruiting District Chicago, enlists 86 new Navy recruits at U.S. Cellular Field
mlb pre-game ceremoniesguaranteed rate field
US Navy 091003-N-5366K-068 Navy Junior ROTC members begin a 1.5-mile run during a Navy SEAL Fitness Challenge held at Grimsley High School. Naval Special Warfare (NSW) operators hosted the event
north carolinagreensboro
US Navy 090929-N-7088A-102 Two Iraqi navy sailors watch as the mine countermeasures ship USS Dextrous (MCM 13) approaches the Iraqi navy pier in Umm Qasr, Iraq
boatsea
US Navy 091006-N-1688B-427 Sailors remove the chocks and chains from a British Royal Navy Lynx helicopter and clear the flight area aboard the guided-missile destroyer USS Cole (DDG 67)
vehiclenavy
US Navy 090721-N-7676W-064 Secretary of the Navy (SECNAV) the Honorable Ray Mabus presents Department of the Navy Distinguished Civilian Service Awards to Drs. Jerome and Isabella Karle during their retirement
groupd.c.,
US Navy 070703-N-8110K-013 Vice Adm. Paul Sullivan, commander of Naval Sea Systems Command, presents a lecture on the future of Navy ships and systems at Boston's historic Old South Meeting House
united states navy images from bostonboston navy week
US Navy 070218-N-7656R-001 Chief Musician Robert Watson, Navy Band Northwest operations chief, plays his trombone in a solo portion of a song at a jazz concert
united states navy images from washington (state)naval undersea museum
US Navy 080523-N-4198C-012 Steelworker Constructionman Chantelle Schweiger and Builder 3rd Class Joshua Knolla, Seabees assigned to Naval Mobile Construction Battalion (NMCB) 3, inspect a truck as it departs Camp Ramadi, Iraq
women in the united states navybuilder (united states navy)
US Navy 071108-N-0000X-001 Navy file photo of Chief of Naval Operations (CNO) Adm. Gary Roughead
chief of naval operationscommand
US Navy 110611-N-NJ145-125 Capt. John W. Gilman and Royal Malaysian Navy Rear Adm. Nasaruddin bin Othman ign the dedication plaque during the turno
royal malaysian navypeople
US Navy 110615-N-CI293-475 U.S. Navy Band Great Lakes, Ceremonial Band, performs a patriotic medley for bikers attending the Sturgis on the River M
armyiowa
US Navy 110725-N-OV802-056 Boatswain's Mate Seaman Mitchel Zeleski instructs Tanzanian navy Capt. A.M. Kihula and Lance Cpl. S.K. Rutungu on the br
united states navy images from kenyaafrica partnership station 2011
US Navy 110725-N-OV802-018 Lt. j.g. Brian Senko instructs Tanzanian navy Capt. A.M. Kihula and Lance Cpl. S.K. Rutungu on the bridge of USS Samuel
united states navy images from kenyaafrica partnership station 2011
US Navy 110622-N-KB666-198 Armada de Chile sailor John Ramon, demonstrates Chilean navy dive gear to members of Mobile Diving and Salvage Unit (MD
peoplechile
US Navy 110922-N-RI844-021 Bangladesh navy and U.S. Navy ships participate in a surface gunnery exercise during Cooperation Afloat Readiness and Tr
vehiclesea
US Navy 120207-N-OY799-032 Aviation Structural Mechanic 3rd Class Tia Squirres performs pre-flight checks on the wing of an E-2C Hawkeye
aboard uss john c. stennis (cvn-74)navy
US Navy 111121-N-RP435-093 Explosive Ordnance Disposal Technician (EOD) 1st Class Thomas Hensen observes Royal Bahrain Navy divers and Royal Bahrai
united states navy explosive ordnance disposalunited states navy images from bahrain
US Navy 100616-N-4776G-785 Navy Diver 1st Class Lars Nilsson is helped out of the water by Navy Diver 2nd Class Taylor Cohee after diving under USS The Sullivans (DDG 68)
uss the sullivans (ddg-68)people
US Navy 100624-N-9818V-116 Sailors present their meals to be judged at the Commander Navy Installations Command's 2nd annual Culinary Competition at CulinAerie
platefood
US Navy 101108-N-8546L-590 Chief Master-at-Arms Mike Hausmann, a U.S. Navy military working dog handler, observes a Uruguayan anti-narcotics police
dog traininguruguay
US Navy 050331-N-0962S-009 Master Chief Petty Officer of the Navy (MCPON) Terry Scott addresses a group of 200 Sailors at the Commander, U.S. Naval Forces Marianas Sailor of the Quarter Awards Breakfast
united states navy images from tumonterry d. scott
US Navy 050330-N-8110K-047 Musician 3rd Class Ken Nieves, a member of the U.S. Navy 6-piece rock band, New Orleans Express, talks with Arlington Heights High School students
peoplegroup
US Navy 011019-N-0000X-001 Navy file photo of Basic Underwater Demolition-SEAL (BUD-S) graduating class 236
group photographs of military peopleunited states navy seals
US Navy 081212-N-9818V-329 Ima Black, widow of the first Master Chief Petty Officer of the Navy, hands the cutlass to Master Chief Petty Officer of the Navy Joe R. Campa, Jr. during the Passing of the Cutlass ceremony
rick d. westjr
US Navy 080825-N-9818V-244 Chief Aviation Warfare Systems Operator Kathleen Reilly, Commander, Navy Reserve Sailor of the Year, addresses her guest after being meritoriously promoted to chief petty officer during the 2008 Navy
fleet logistics support squadron 53 (united states navy)aviation warfare systems operator
US Navy 100714-N-8132M-049 Navy and Marine Corps ceremonial color guard members take part in the full honors arrival ceremony for Commander of the Royal Bahrain Naval Force Brig. Gen. Abdulla Saeed Al Mansoori
color guards of the united states navywashington navy yard
US Navy 100722-N-1134I-063 Navy Diver 2nd Class Troy Crowder uses hand signals to communicate with a Mexican navy diver during a salvage recovery exercise
underwaterwater
US Navy 100331-N-6932B-321 An M-16 rifle is disassembled for cleaning at the U.S. Navy Individual Augmentee Combat Training course at Fort Jackson, S.C
field-stripping riflesrifle cleaning
US Navy 070505-N-7029R-061 Crewmembers from a Brazilian navy helicopter prepare to take off from USS Pearl Harbor (LSD 52) during UNITAS exercises
militaryvehicle
US Navy 070902-N-7163S-001 A member of the U.S. Navy Parachute Team, the Leap Frog, trails smoke while descending to the landing zone during a demonstration at the Cincinnati Riverfest
militaryaircraft
US Navy 050808-N-4772B-038 A pair of Royal Brunei Navy (RBN) divers are lowered from the rescue and salvage ship USS Safeguard (ARS 50) during familiarization dives
underwater diversbrunei
US Navy 050808-N-4772B-044 A pair of Royal Brunei Navy (RBN) divers are lowered from the rescue and salvage ship USS Safeguard (ARS 50) during familiarization dives
bruneiboat
Birds navy eagle eagle
wildlifebird
Fly navy jet
aircraftvehicle
Marine navy airfare
militaryarmy
Navy military vessel
militarywater
United states navy formation flight
aircraftvehicle
2018 Army-Navy football game line of scrimmage (46211618112)
competitionsport
FGS Pegnitz, a German navy minsweeper, participates in BALTOPS 2013. (9069862924)
oceansea
Flickr - Official U.S. Navy Imagery - A Sailor aims an M4 rifle during a small arms qualification.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor welds a bracket for a jig in the sheet metal shop.
images from united states navy to checklight
Flickr - Official U.S. Navy Imagery - A Sailor instructs during a .50-caliber machine gun qualification.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor serves as phone talker during an underway replenishment.
images from united states navy to checkpeople
Flickr - Official U.S. Navy Imagery - A Sailor stows hoses after flight deck firefighting drills.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - A Sailor track contacts in the combat direction center.
lowlightlight
Flickr - Official U.S. Navy Imagery - CNO salutes a wreath at the Navy Memorial.
washingtonpeople
Flickr - Official U.S. Navy Imagery - An Iranian mariner greets a U.S. Coast Guardsmen.
peoplegroup
Flickr - Official U.S. Navy Imagery - Cmdr. Yevsey Goldberg conducts an acupuncture procedure. (2)
images from united states navy to checkacupuncture
Flickr - Official U.S. Navy Imagery - Corpsman observes refueling operation to ensure safety procedures are followed.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Holocaust Remembrance Day event at the Pentagon.
images from united states navy to checkholocaust remembrance day
Flickr - Official U.S. Navy Imagery - Lt. Cmdr. Curtis Gaball checks the airway of a Cambodian man.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Sailor clears lines from pallets of stores as they arrive in hangar.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Medical and rescue personnel assist in airlifting an injured crew member.
images from united states navy to check
Flickr - Official U.S. Navy Imagery - Military spouse contestants play Wheel of Fortune.
shoppinglight
Flickr - Official U.S. Navy Imagery - Pacific Partnership briefing at Pentagon.
images from united states navy to checkpentagon press briefing room
Flickr - Official U.S. Navy Imagery - Partner nation ships move into formation.
flightfly
Flickr - Official U.S. Navy Imagery - USS McCambell departs Yokosuka Harbor.
boatsea
Flickr - Official U.S. Navy Imagery - USS Stockdale Sailor prepares lunch for the crew.
shoppingfood
Flickr - Official U.S. Navy Imagery - Sailors combat a simulated engine room fire.
swordspeople
Flickr - Official U.S. Navy Imagery - Sailors practice fire fighting at sea. (3)
peoplegroup
Flickr - Official U.S. Navy Imagery - Sailors participate in a physical training session.
aircraftvehicle
Flickr - Official U.S. Navy Imagery - Sailors participate in a wheelchair basketball game. (1)
images from united states navy to checkwheelchair basketball
Flickr - Official U.S. Navy Imagery - Sailors perform routine maintenance on an MK-32 torpedo launcher.
images from united states navy to check
3701 - 3800 of 94,982 Next page
/ 950