25,206 Free Photos of John

aboard uss john c. stennis (cvn-74)cc-zerofiles uploaded by daderotvehiclecc-pd-marknavyplantsmilitaryaircraftauthor died more than 70 years ago public domain images
Reception room - Cà d'Zan - Circus Museum - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00238
self-published workinterior
Chair 1 of 2, Ballroom - Cà d'Zan - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00251
self-published workgold
Breakfast room - Cà d'Zan - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00285
interior designinterior
Saint John the Baptist Catholic School in Washington street, entering Barangay Sucol beside Poblacion and Caniogan, Calumpit, Calumpit, Bulacan Syzygium samarangense Wax apples Tamarindus indica, Ba
foodtree
Sericornis arfakiana (=Sericornis arfakianus) in The birds of New Guinea and the adjacent Papuan islands, including many new species recently discovered in Australia. v.3 (Plate 6).
animalsbird
Cornwall st ives reeds
landscapetravel
Edward Coke, The Fourth Part of the Institutes of the Laws of England (2nd ed, 1648, frontispiece and title page) - 20131124
frontispieces from englandopen book
Flickr - Official U.S. Navy Imagery - A jet lands on the deck of USS John C. Stennis.
militaryvehicle
President Ronald Reagan during a meeting in the Oval Office
ronald reagan and george h. w. bushd.c.,
Johannes Albertus, polsk biskop (1621-33), målad 1688-1703 - Skoklosters slott - 98174
17th-century portraits with coat of armswar trophies seized by sweden
Chief of Naval Operations Adm John Richardson visits the Arleigh Burke-class guided missile destroyer USS McCampbell (DDG 85) during India's International Fleet Review (IFR) 2016
military relations of india and the united statesinternational fleet review 2016
US Navy 050527-N-6477M-218 Naval Station Everett Chaplain, Lt. Cmdr. John M. Hakanson renders a salute after placing an American flag at the headstone of a veteran at the Grand Army of the Republic Cemetery in Snohomish, Wash
washingtonlawn
US Navy 040825-N-8704K-004 A Naval Aviator assigned to the Diamond Cutters of Sea Control Squadron Three Zero (VS-30), conducts a flyby over the aircraft carrier USS John F Kennedy (CV 67)
sea control squadron 30 (united states navy)s-3b viking
US Navy 051020-N-3729H-093 U.S. Navy Airman Eric Labrecque, assigned to the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74), enters a church in Slidelle, La., during cleanup efforts
united states navy images from louisianareflections of stained-glass windows
Navy JAG Corps Welcomes New Leadership 210817-N-AT530-0229
groupjr
Officers and Men of Trans-Atlantic Flight
militaryarmy
US Navy 101029-N-5085J-155 The official party vcut the ribbon during the Fleet Weather Center Norfolk, Va. establishment ceremony at Naval Station
virginianorfolk
US Navy 070620-N-3729H-091 Flight deck crew members watch an E-2C Hawkeye, from the
aircraftvehicle
US Navy 101207-N-7589W-076 Equipment Operator 3rd Class John Guillenagudelo, center, assigned to Naval Mobile Construction Battalion (NMCB) 28,
naval mobile construction battalion 28southern partnership station 2010
US Navy 090211-N-6597H-065 Aviation Electrician's Mate 3rd Class Jon Miller, from Waterford, Mich., performs scheduled electrical maintenance on an F-A-18C Hornet from the
aboard uss john c. stennis (cvn-74)people
US Navy 110622-N-KB666-198 Armada de Chile sailor John Ramon, demonstrates Chilean navy dive gear to members of Mobile Diving and Salvage Unit (MD
peoplechile
US Navy 090423-N-9758L-146 The Arleigh Burke-class guided-missile destroyer USS Hopper (DDG 70) makes her way pier side to Naval Station Pearl Harbor
boatship
US Navy 080822-N-9123L-007 U.S. Pacific Fleet Bandmaster Lt. Bruce McDonald conducts Royal Australian Navy Leading Seaman Tracy Burke during the Royal Australian Navy's presentation of
united states navy images from sydneyaboard uss john s. mccain (ddg-56)
US Navy 081021-N-9928E-057 The Arleigh Burk-class guided-missile destroyer USS Kidd (DDG 100) steams behind the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
vehiclesea
US Navy 081031-N-4954I-002 Aviation Machinist's Mate 3rd Class HuanChing Nieh cleans tools as Aviation Machinist's Mate 2nd Class Rayson nventories a tool box
aviation machinist's matetoolbox
US Navy 081013-N-4954I-003 Chief Cryptologic Technician (Collection) Benjamin Meyer, left, from Fairfax, Va., and Cryptologic Technician (Technical) 3rd Class Josh Bundy, from Denver, inspect the Nixie torpedo countermeasure ca
aboard uss john c. stennis (cvn-74)group
US Navy 090430-N-9928E-091 Fire Controlman 2nd class Jared Mendoza, from Langley, Wash., removes spent rounds from a Close-In Weapons System after a live fire exercise on the fantail aboard the Nimitz-class aircraft carrier USS
aboard uss john c. stennis (cvn-74)fire controlman
US Navy 090523-N-5345W-307 Sailors aboard the amphibious dock landing ship USS Fort McHenry (LSD 43) watch from the conning station as the military sealift command fleet replenishment oiler USNS John Lenthall (T-AO 189), center
vehiclesea
US Navy 091015-N-3090M-450 The attack submarine USS Virginia (SSN 774) departs Naval Submarine Base New London to begin her first scheduled full-length deployment
waterboat
US Navy 060828-N-1805P-004 Medical Corps Navy Reserve Capt. Matthew Gratton answers questions from local media after being awarded a Bronze Star by Chief of Naval Personnel, Vice Adm. John C. Harvey Jr., during opening ceremoni
medical detachments of the united states armycleveland navy week
US Navy 070315-N-2659P-127 Aviation Boatswain's Mate Airman Recruit Billy Crook stands ready to respond to any fire or emergency that might arise as part of the crash and salvage team aboard Nimitz-class aircraft carrier USS Jo
aviation boatswain's matemilitary
US Navy 070522-N-3541A-030 Maritime Operations help set the conditions for security and stability, as well as complement counter-terrorism and security efforts to regional nations
peoplelight
US Navy 070529-N-2659P-066 Aviation Boatswain's Mate (Equipment) 2nd Class Joseph Mikes from air department's launch and recovery division charges an arresting gear engine to recover aircraft aboard Nimitz-class aircraft carrie
aviation boatswain's mateequipment
US Navy 060605-N-4772B-010 Midshipman 2nd Class John D. Jones gets small arms training on the bridgewing of the amphibious dock landing ship USS Harpers Ferry (LSD 49)
m60 machine gun in us navy serviceaboard uss harpers ferry (lsd-49)
US Navy 070123-N-3729H-131 An F-A-18C Hornet assigned to the Blue Diamonds of Strike Fighter Squadron One Four Six (VFA-146) sits ready to launch as Sailors from air department clear the catapult
strike fighter squadron 146 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 071110-N-5328N-854 The No. 6 jet flown by Lt. Cmdr. Craig R. Olson and the No. 5 jet flown by Lt. Cmdr. John D. Allison
militaryvehicle
US Navy 120206-N-GC412-466 Airman James Rice paints the squadron designator on the vertical stab on an F-A-18F Super Hornet from the Black Aces of
f/a-18f super hornetskateboarding
US Navy 120207-N-OY799-032 Aviation Structural Mechanic 3rd Class Tia Squirres performs pre-flight checks on the wing of an E-2C Hawkeye
aboard uss john c. stennis (cvn-74)navy
US Navy 111218-N-BT887-057 A Sailor gives the signal to add tension to the catapult to launch an E-2C Hawkeye assigned to the Golden Hawks of Airbo
militaryvehicle
US Navy 120101-N-OY799-089 Aviation Boatswain's Mate (Equipment) 2nd Class Lian Lawrence stands waist safety as an F-A-18E Super Hornet from the To
f/a-18e super hornet on flight decksaboard uss john c. stennis (cvn-74)
US Navy 110520-N-OY799-168 An F-A-18F Super Hornet from the Black Aces of Strike Fighter Squadron (VFA) 41 is parked on aircraft elevator three abo
vehicleship
US Navy 110611-N-NJ145-125 Capt. John W. Gilman and Royal Malaysian Navy Rear Adm. Nasaruddin bin Othman ign the dedication plaque during the turno
royal malaysian navypeople
US Navy 110929-N-WW409-249 Rear Adm. William McQuilkin, commander of U.S. Naval Forces Korea, left, and Rear Adm. J.R. Haley, commander of Task For
celebritiespeople
US Navy 111017-N-VN693-553 wo F-A-18C Hornets assigned to the Golden Dragons of Strike Fighter Squadron (VFA) 192 fly over the aircraft carrier USS
aircraftvehicle
US Navy 110808-N-BT887-104 Aviation Electrician's Mate 3rd Class James Kirby checks the flight deck and airspace before signaling to an MH-60S Sea
aviationvehicle
US Navy 111030-N-OY799-195 Aviation Structural Mechanic Airman Morgan Angle stands by an F-A-18C Hornet from the Golden Dragons of Strike Fighter S
militaryvehicle
A Sailor directs an EA-6B Prowler. (8695598297)
militaryvehicle
View from ruins of old castle of Order of Saint John near Antimachia on Kos island (Greece)
landscapetravel
Große Fetthenne (Hylotelephium telephium) in Hockenheim
crassulaceaeplants
Große Fetthenne (Hylotelephium telephium) in Hockenheim
naturespring
The zoology of the voyage of the H.M.S. Erebus & Terror, under the command of Captain Sir James Clark Ross, during the years 1839 to 1843. By authority of the Lords Commissioners of the Admiralty
animalsmammals
With Antarctica's Mount Erebus in the background, an Adélie penguin is seen on November 11, 2016, while U.S. Secretary of State John Kerry conducted a helicopter tour of U.S. research facilities aroun
animalsbird
US Navy 090701-N-6538W-196 The aircraft carrier USS John C. Stennis (CVN 74) gets underway from Everett, Wash. during a Tiger Cruise to San Diego to offload Carrier Air Wing (CVW) 9 before returning to homeport in Bremerton, Wa
united states navy images from puget sound
US Navy 090703-N-9818V-390 Master Chief Petty Officer of the Navy (MCPON) Rick West has an Ombudsman's call at Commander, Fleet Activities Yokosuka, Japan
yokosuka naval base in the 2000sgroup
US Navy 090707-N-7092S-145 Ens. John Guzman uses an azimuth circle aboard the guided-missile frigate USS Kauffman (FFG 59) during leapfrog exercises with the Royal Navy destroyer HMS Manchester (D 95), not pictured, off the coa
southern seas 2009azimuth circles
US Navy 070814-N-3038W-222 Overlooking the captain's chair on the bridge aboard Nimitz-class aircraft carrier USS John C. Stennis (CVN 74), USS Antietam (CG 54), USS Preble (DDG 88) and USS O'Kane (DDG 77) transit in formation
aboard uss o'kane (ddg-77)valiant shield 2007
US Navy 080613-N-9150R-051 Cmdr. John Eckert, embarked aboard the military Sealift Command hospital ship USS Boxer (LHD 4), injects a goat with vitamins at a rural family goat farm in the Huacho region of Peru
animalsarmy
Blaze flame red
symbolyellow
Cuellar - Convento de Santa Clara 11
architecturegold
Christ on the Cross between the Virgin and SS. John, Adolphus, and Ambrose, by Dieric Bouts followers, oak - Bode-Museum - DSC03193
self-published workcc-pd-mark
Boiler room, Lukens Iron and Steel Co., Caotesville PA., T.S. 60000, Builders John H. Dialogue & Son, Camden N.J. 1908 - Hercules - Hyde Street Pier - San Francisco, CA DSC02244
self-published workcc-zero
Card table, attributed to Thomas Seymour, carving attributed to Thomas Wightman, Boston, 1816-1817, rosewood, mahogany, birds-eye maple veneer, chestnut, ash, brass and brass powder - Winterthur Museum - DSC01431
self-published work1810s furniture
Clock, French, late 1800s - Cà d'Zan - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00363
19th-century clocksgold
Captain John Somes by Benjamin Blyth, c. 1780, pastel and paper mounted on canvas - Cape Ann Museum - Gloucester, MA - DSC01062
self-published workcc-pd-mark
Bassussarry vitrail St Jean Baptiste
self-published workarchitecture
Forty Steps, Newport, Rhode Island, by John Frederick Kensett, 1860, oil on canvas - Peabody Essex Museum - DSC07205
seashorewater
Nijmegen, Antonius van Padua kerk, raam 10
self-published workarchitecture
Johann Georg, Herzog von Anhalt, by an unknown artist, 1618 - Bode-Museum - DSC02799
self-published workgold
The Virgin with Jesus and St. John the Baptist, by Christian Kirchner (1691-1732), Dresden, c. 1530 - Bode-Museum - DSC03371
self-published workcc-pd-mark
Old Westford Academy bell, presented by John William Abbot, Aug. 2, 1897, Knowledge is Power - Westford, Massachusetts - DSC09054
self-published workknowledge is power
Tweede kamer bezoekt Afghanistan
architecturesidewalk
Stateroom A ceiling - Wisconsin Railroad Car, Pullman Company, 1905 - Circus Museum - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00440
self-published workshopping
Stateroom B - Wisconsin Railroad Car, Pullman Company, 1905 - Circus Museum - John and Mable Ringling Museum of Art - Sarasota, FL - DSC00430
self-published workcc-pd-mark
St. John the Baptist by Andrea Sansovino, early 1500s, and Adam, Zaccariah, and Habakkuk, by Matteo Cividali, second half of the 15th century, marble - San Lorenzo (Genoa) - DSC01926
self-published workarchitecture
St. Benedict Nebraska City NE window 3
self-published workarchitecture
Sunset harbour sea
waterboat
Große Fetthenne (Hylotelephium telephium) in Hockenheim
crassulaceaeplants
US Navy 090705-N-6538W-252 Officer of the boat Lt j.g. Paul Kaufman, from Roberts, Mont., left, and Boatswain's Mate 2nd Class Chris Boosalis, from Lancaster, Calif., operate a rigid hulled inflatable boat during a man overboar
aboard uss john c. stennis (cvn-74)man overboard drill
Mystical romantic creepy
symbolyellow
Storängsudds naturreservat, styvmorsviol
springplants
Große Fetthenne (Hylotelephium telephium) in Hockenheim
crassulaceaeplants
Große Fetthenne (Hylotelephium telephium) in Hockenheim
crassulaceaeplants
Juniperus occidentalis var. australis, eastern Sierra Nevada, Rock Creek Canyon, California.
cupressaceaeplants
US Navy 020716-N-6492H-522 USS Kennedy - Hornet landing
vehiclesea
US Navy 051119-N-9693M-025 U.S. Naval Academy Midshipman defensive end John Chan (foreground) is congratulated on running in a 41 yard touchdown following a Temple Owls fumble during the 4th quarter of play at Navy-Marine Corps
u.s. naval academy midshipmen vs. temple university owls nov. 192005
US Navy 020713-N-6492H-517 C-2A landing
militaryvehicle
The Kennedy family poses with SECNAV at the ship name unveiling. (29540205430)
groupjr
US Navy 070802-N-3729H-158 An aircraft director, from air department's flight deck division, motions an EA-6B Prowler from the
aircraftvehicle
US Navy 070806-N-7883G-014 Sailors aboard the USS Kitty Hawk (CV 63), send cargo to the Military Sealift Command oiler USNS John Ericsson (T-AO 194) during a refueling at sea (RAS)
cargo in transfer (underway replenishment)personnel at underway replenishment
US Navy 070806-N-3038W-246 The guided missile cruiser USS Antietam (CG 54) commences her approach alongside the Military Sealift Command fast-combat support ship USNS Bridge (T-AOE 10)
boatsea
US Navy 080621-N-0684R-051 Final safety checkers give thumbs up before an EA-6B Prowler from the
grumman ea-6 prowler aircraft carrier launchesaboard uss john c. stennis (cvn-74)
Svenska och norska riksbaneren i Karl XIV Johans begravningståg, 1844 - Livrustkammaren - 108763
images from livrustkammarenprinting
US Navy 041120-N-5345W-094 Chief Quartermaster Charles Baker sends signals via signal light from the Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75) to Quartermasters aboard the conventionally powered aircraft carrie
aboard uss john f. kennedy (cv-67)naval signalling lamps
US Navy 090913-N-3541A-059 Aviation Maintenance Administrationman 3rd Class Shon Nutting, and area business owner Jonathan Buesch wheel the rusted front end metal from an abandoned vehicle in Illahee Forest Preserve in East Bre
puget sound naval shipyard in the 2000saboard uss john c. stennis (cvn-74)
US Navy 090914-N-5345W-263 Chief Damage Controlman Donald Grothe supervises Hull Maintenance Technician 3rd Class John South and Damage Controlman Fireman David Pritchard during a hose-handling training exercise
aboard uss fort mchenry (lsd-43)damage controlman
US Navy 091008-N-5345W-017 Seaman John Mendez, left, Boatswain's Mate Seaman Antoinette Smith and Boatswain's Mate 1st Class Jay Collette watch an approaching helicopter from the flight deck of the amphibious dock landing ship
boatswain's mate (united states navy)aboard uss fort mchenry (lsd-43)
US Navy 091114-N-2475A-294 Logistics Specialist 3rd Class Paul Scott and Logistics Specialist 3rd Class Christopher Duane hook cargo onto an MH-60S Sea Hawk helicopter
aboard uss john c. stennis (cvn-74)logistic specialist
US Navy 100123-N-2475A-122 viation Boatswain's Mate (Fuel) Airman Jaquine Baker, from Las Vegas, walks an urn to the committal petty officer during a burial at sea
aviation boatswain's matefuel
US Navy 090507-N-2475A-154 An SA-330 Puma helicopter assigned to the Military Sealift Command combat support ship USNS Concord (T-AFS 5) lifts pallets from Concord's flight deck to deliver to the Ticonderoga-class guided-missil
shipsea
US Navy 090615-N-2475A-010 Aviation Boatswain's Mate (Handling) Airman Kelsey Gifford, from Augusta, Ga., communicates with hangar deck control while hangar bay personnel transfer a F-A-18C Hornet
militarynavy
11401 - 11500 of 25,206 Next page
/ 253