34,298 Free Photos of C

cc-zerocc-pd-markvehicleaboard uss john c. stennis (cvn-74)files uploaded by daderotauthor died more than 100 years ago public domain imagesplantsaircraftnavyaviation
Basket, Aleut, c. 1900, seagrass, wool thread - Portland Art Museum - Portland, Oregon - DSC09116
indigenous art of the americas in the portland art museumself-published work
US Navy 110208-N-4743B-287 A landing craft utility pulls into Sattahip Naval Base to offload Marines and their equipment to take part in exercise C
vehiclewater
US Navy 110606-N-BT887-007 Aviation Machinist's Mate Airman Julian Parrera, from Bogata, Columbia, cleans the canopy of an F-A-18C Hornet from the
aircraftvehicle
US Navy 111021-N-GO535-291 Deputy Chief of Navy Reserve, Rear Adm. Bryan Cutchen is interviewed at Boeing's integrated defense systems facility aft
united states navy images from kansaskansas
US Navy 110920-N-FG395-014 The Peruvian navy submarine BAP Antofagasta (SS 32) arrives in Naval Submarine Base Kings Bay for a port visit
waterboat
US Navy 110920-N-VN693-188 Aviation Boatswain's Mate Airman Jose Morales, from Santa Isabelle, P.R., prepares to remove chalks and chains before mo
nightdark
Helichrysum retortoides specimen in the University of California Botanical Garden, Berkeley, California, USA.
plantsseason
Helichrysum stoechas habit, Dehesa Boyal de Puertollano, Spain
foliageplants
Hate 18. - . i^c-m.NatureliyB.^atei-Taim.seBavaaiiS . 3.ay £Hadae liXiH- i to the §ucoft - 1_6 . CHJi T MY S SUB S P IN S U S 7_1Z.SC1URUS GB.ISEO'CA."UDATUS
animalsmammals
Figure 4; Select examples of ascospore morphologies in Graphidaceae and Leotiomycetes a ascospores of Glyphis cicatricosa in Lugol’s solution b muriform ascospore of Mellitiosporium versicolor c–e mur
glyphis cicatricosafungus
Vase by Stevens and Williams, England, c. 1887, blown Osiris glass - Portland Museum of Art - Portland, Maine - DSC04313
self-published workcc-pd-mark
Plate with enameled Mandarin decoration, China, c. 1770-1780, porcelain - Krannert Art Museum, UIUC - DSC06596
platefood
Teapot, Staffordshire, England, c. 1740-1745, glazed earthenware - Montreal Museum of Fine Arts - Montreal, Canada - DSC09222
self-published workcc-pd-mark
Teapot, England, probably Staffordshire, c. 1760, salt-glazed stoneware - Montreal Museum of Fine Arts - Montreal, Canada - DSC09230
self-published workcc-pd-mark
Tea production in China, Guangzhou, detail, c. 1800 AD, oil on canvas - Peabody Essex Museum - Salem, MA - DSC05280
villagetown
Loetz glass, made by Glasfabrik Johann Loetz Witwe, Klostermühle (Bohemia), c. 1900, glass - Bröhan Museum, Berlin - DSC03951
self-published workcc-pd-mark
Antioxidant ascorbic acid banana
healthfood
Pear apple food
kitchenfood
Drink glass yellow
vegetablesfood
Der Tempel der Juno in Agrigent (C D Friedrich)
1820s paintings by caspar david friedrich19th-century paintings of ruins
Flickr - Official U.S. Navy Imagery - A jet lands on the deck of USS John C. Stennis.
militaryvehicle
Iranian - Cylinder Seal - Walters 42775 - Side C
cuneiform on cylinder sealsfigure
One C&O Train Coming Out of and One Going Into Fort Springs Tunnel -- 5 Photos (31995261991)
vehiclecar
AV-8As VMA-231 approaching USS FD Roosevelt (CV-42) 1977
vehiclesea
U.S. Navy C-21A Learjet in snow
vehiclewinter
US Navy 050526-F-6655M-223 Navy A School students assigned to Naval Air Station Pensacola, Fla., onload a WC-130J Hurricane Hunter from the 53rd Weather Reconnaissance Squadron, Keeseler Air Force Base, Miss
aircraftvehicle
US Navy 050830-C-3721C-071 U.S. Coast Guard Petty Officer 2nd Class Scott D. Rady of Tampa, Fla., gives the signal to hoist-up a pregnant woman from her apartment during a search and rescue (SAR) flight in New Orleans
vehiclewater
US Navy 040530-C-1034C-045 Members assigned to the U.S. Coast Guard Law Enforcement Detachment Four Zero Three (USCG LEDET- 403), based out of Miami, Fla., teach members of the French, Spanish and Italian Navies basic Law Enfor
people of the united states coast guardunited states navy in the persian gulf
US Navy 040526-C-5313L-080 Crew members assigned to the Keeper-class coastal bouy tender Katherine Walker (WLM 552) render honors to the guided missile frigate USS Robert G. Bradley (FFG 49)
seasidesea
US Navy 051020-N-3729H-093 U.S. Navy Airman Eric Labrecque, assigned to the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74), enters a church in Slidelle, La., during cleanup efforts
united states navy images from louisianareflections of stained-glass windows
US Navy 031113-N-5821W-005 Lt. Johnny Williams, a member of NAS Sigonella's Mediterranean Express (MEDEX), checks the propeller
militaryvehicle
US Navy 101029-N-5085J-155 The official party vcut the ribbon during the Fleet Weather Center Norfolk, Va. establishment ceremony at Naval Station
virginianorfolk
US Navy 070620-N-3729H-091 Flight deck crew members watch an E-2C Hawkeye, from the
aircraftvehicle
US Navy 110126-N-7981E-040 The Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) leads the Royal Malaysian Navy frigate KD Lekir (FF 26) and c
vehiclesea
US Navy 090211-N-6597H-065 Aviation Electrician's Mate 3rd Class Jon Miller, from Waterford, Mich., performs scheduled electrical maintenance on an F-A-18C Hornet from the
aboard uss john c. stennis (cvn-74)people
US Navy 110126-N-7981E-018 The Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) leads the Royal Malaysian Navy frigate KD Lekir (FF 26) and c
vehicleboat
US Navy 110215-N-6632S-008 A C-2 Greyhound assigned to Fleet Logistics Support Squadron (VRC) 40 lands aboard the aircraft carrier USS George H.W
vehiclefly
US Navy 090423-N-9758L-146 The Arleigh Burke-class guided-missile destroyer USS Hopper (DDG 70) makes her way pier side to Naval Station Pearl Harbor
boatship
US Navy 081021-N-9928E-057 The Arleigh Burk-class guided-missile destroyer USS Kidd (DDG 100) steams behind the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74)
vehiclesea
US Navy 081031-N-4954I-002 Aviation Machinist's Mate 3rd Class HuanChing Nieh cleans tools as Aviation Machinist's Mate 2nd Class Rayson nventories a tool box
aviation machinist's matetoolbox
US Navy 090622-N-9988F-004 Chief petty officers assigned to Carrier Air Wing (CVW) 7 carry the casket of Command Master Chief Jeffrey J. Garber during a departure ceremony aboard the aircraft carrier USS Dwight D. Eisenhower (C
flight deck of uss dwight d. eisenhower (cvn-69)navy
US Navy 081013-N-4954I-003 Chief Cryptologic Technician (Collection) Benjamin Meyer, left, from Fairfax, Va., and Cryptologic Technician (Technical) 3rd Class Josh Bundy, from Denver, inspect the Nixie torpedo countermeasure ca
aboard uss john c. stennis (cvn-74)group
US Navy 090430-N-9928E-091 Fire Controlman 2nd class Jared Mendoza, from Langley, Wash., removes spent rounds from a Close-In Weapons System after a live fire exercise on the fantail aboard the Nimitz-class aircraft carrier USS
aboard uss john c. stennis (cvn-74)fire controlman
US Navy 090516-N-3946H-010 Capt. Michael C. Manazir, left, commanding officer of the aircraft carrier USS Nimitz (CVN 68), oversees a replenishment at sea with the Military Sealift Command fleet replenishment oiler USNS Yukon (
aboard uss nimitz (cvn-68)ship
US Navy 061202-N-3642E-106 Navy leadership render honors during opening ceremonies at the Army vs. Navy football game
male military people salutinggroup
US Navy 060828-N-1805P-004 Medical Corps Navy Reserve Capt. Matthew Gratton answers questions from local media after being awarded a Bronze Star by Chief of Naval Personnel, Vice Adm. John C. Harvey Jr., during opening ceremoni
medical detachments of the united states armycleveland navy week
US Navy 060820-N-9076B-013 The Military Sealift Command (MSC) hospital ship USNS Mercy (T-AH 19) is anchored off the coast of Kupang for one week while the crew provides humanitarian and civic assistance to the people of this c
boatsea
US Navy 070315-N-2659P-127 Aviation Boatswain's Mate Airman Recruit Billy Crook stands ready to respond to any fire or emergency that might arise as part of the crash and salvage team aboard Nimitz-class aircraft carrier USS Jo
aviation boatswain's matemilitary
US Navy 070316-N-8923M-045 Sailors watch a drinking and driving documentary during the Recording Artist Athletes and Actors Against Drunk Driving (RADD) Readiness Tour aboard Nimitz-class aircraft carrier USS Harry S. Truman (C
aboard uss harry s. truman (cvn-75)naval station norfolk
US Navy 070522-N-3541A-030 Maritime Operations help set the conditions for security and stability, as well as complement counter-terrorism and security efforts to regional nations
peoplelight
US Navy 070529-N-2659P-066 Aviation Boatswain's Mate (Equipment) 2nd Class Joseph Mikes from air department's launch and recovery division charges an arresting gear engine to recover aircraft aboard Nimitz-class aircraft carrie
aviation boatswain's mateequipment
US Navy 060202-N-2838C-016 A pilot assigned to the Rawhides of Fleet Logistics Support Squadron Four Zero (VRC-40) Detachment One signals to the plane captain
uss theodore roosevelt (cvn-71) flight deckpeople
US Navy 060506-N-0780W-001 Vice Adm. Donald Arthur addresses troops aboard the Military Sealift Command (MSC) hospital ship USNS Comfort (T-AH 20) during an admiral's call
aboard usns comfort (t-ah-20)army
US Navy 070123-N-3729H-131 An F-A-18C Hornet assigned to the Blue Diamonds of Strike Fighter Squadron One Four Six (VFA-146) sits ready to launch as Sailors from air department clear the catapult
strike fighter squadron 146 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 070203-N-1226D-145 Boatswain's Mate Tony Nunez, a reservist with Beach Master's Unit One (BMU-1), Team C, gives directions to a Kalmar Rough Terrain Container Handler
us navy in puerto quetzalseaside
US Navy 120206-N-GC412-466 Airman James Rice paints the squadron designator on the vertical stab on an F-A-18F Super Hornet from the Black Aces of
f/a-18f super hornetskateboarding
US Navy 120207-N-OY799-032 Aviation Structural Mechanic 3rd Class Tia Squirres performs pre-flight checks on the wing of an E-2C Hawkeye
aboard uss john c. stennis (cvn-74)navy
US Navy 111218-N-BT887-057 A Sailor gives the signal to add tension to the catapult to launch an E-2C Hawkeye assigned to the Golden Hawks of Airbo
militaryvehicle
US Navy 120101-N-OY799-089 Aviation Boatswain's Mate (Equipment) 2nd Class Lian Lawrence stands waist safety as an F-A-18E Super Hornet from the To
f/a-18e super hornet on flight decksaboard uss john c. stennis (cvn-74)
US Navy 110520-N-OY799-168 An F-A-18F Super Hornet from the Black Aces of Strike Fighter Squadron (VFA) 41 is parked on aircraft elevator three abo
vehicleship
US Navy 110929-N-WW409-249 Rear Adm. William McQuilkin, commander of U.S. Naval Forces Korea, left, and Rear Adm. J.R. Haley, commander of Task For
celebritiespeople
US Navy 111017-N-VN693-553 wo F-A-18C Hornets assigned to the Golden Dragons of Strike Fighter Squadron (VFA) 192 fly over the aircraft carrier USS
aircraftvehicle
US Navy 110808-N-BT887-104 Aviation Electrician's Mate 3rd Class James Kirby checks the flight deck and airspace before signaling to an MH-60S Sea
aviationvehicle
US Navy 111030-N-OY799-195 Aviation Structural Mechanic Airman Morgan Angle stands by an F-A-18C Hornet from the Golden Dragons of Strike Fighter S
militaryvehicle
US Navy 100714-N-5082P-019 Aviation Boatswain's Mate (Equipment) Airman Anthony E. Blanchfield performs pre-operation maintenance on the shuttle and spread component of catapult one aboard the aircraft carrier USS Enterprise (C
aviation boatswain's mateequipment
US Navy 100118-N-7032B-106 Medical staff board an aircraft at Naval Air Station North Island to go to Haiti in support of Operation Unified Response
militaryaircraft
A Sailor directs an EA-6B Prowler. (8695598297)
militaryvehicle
David Taylor Model Basin - exterior view, c. 1946
monochromemaryland
Bünker 1902 S 056 sw Gasperle Haus Treffling
pencil drawingarchitecture
Helichrysum bracteatum (Garten-Strohblume) - Botanischer Garten Leipzig
plantsflower
La Jardin Baliwag Home of Divine Mercy & Retreat House (Catulinan, Baliuag, Bulacan) 14°58'5"N 120°52'36"E Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum v
eggplantplants
Siling mahaba Sileng-haba (Tag.) Capsicum annuum Banana peppers var. longum C. annuum var. longum Sendt. Capsicum annuum var. longum in the Philippines; Solanum melongena fields in the Philippines Gra
plantsgreen
Solanum melongena fields in the Philippines, Matictic-Pinagtulayan, Norzagaray, Bulacan Farm to Market Road in Barangay Pinagtulayan, beside Bakas, Matictic Norzagaray Bulacan River (Amador C. Dela Me
agriculturespring
Solanum melongena fields in the Philippines, Matictic-Pinagtulayan, Norzagaray, Bulacan Farm to Market Road in Barangay Pinagtulayan, beside Bakas, Matictic Norzagaray Bulacan River (Amador C. Dela Me
agriculturespring
Herbs of the Philippines Bay, Laguna National Highway List of barangays in Laguna (province) Barangays Calo, Bay, Laguna 14.1838, 121.2810 Maitim, Bay, Laguna 14.1857, 121.2733 Bay, Laguna along Bay–C
natureplants
Herbs of the Philippines Bay, Laguna National Highway List of barangays in Laguna (province) Barangays Calo, Bay, Laguna 14.1838, 121.2810 Maitim, Bay, Laguna 14.1857, 121.2733 Bay, Laguna along Bay–C
natureplants
*Isoberlinia doka Craib & Stapf Object Details Biogeographical Region 22 - West Tropical Africa Collector C. Vigne Record Last Modified 8 Apr 2017 Specimen Count 1 Barcode 00243079 USNM Number 142
plantsusa
Portrait of Vibia Sabina, wife of Emperor Hadrian. Marble, ca. 135 CE. Français : Portrait de Sabine, épouse de l'empereur Hadrien. Marbre, vers 135 ap. J.-C. Provenance: Via Appia.
lepidopterapieridae
Fig. 1 Pseudalsophis dorsalis (=Dromicus chamissonis var. dorsalis). 1a. top view of the head, 1 b. side view and 1 c. bottom view of the head. Fig. 2. Pseudalsophis biserialis (= Dromicus chamissoni
reptilesanimals
Malaclemys terrapin syn. Malaclemmys centrata Malaclemmys centrata. Specimens from Beaufort, N. C. Figs. 1 and 2, an adult male 4 inches long. Fig.3, a 3-inch femals; fig.4, a 4 1/2-inch female Subj
reptilesanimals
US Navy 090701-N-6538W-196 The aircraft carrier USS John C. Stennis (CVN 74) gets underway from Everett, Wash. during a Tiger Cruise to San Diego to offload Carrier Air Wing (CVW) 9 before returning to homeport in Bremerton, Wa
united states navy images from puget sound
en:Flax stem cross-section, showing locations of underlying tissues. Ep = epidermis; C = cortex; BF = en:bast fibres; P = en:phloem; X = en:xylem; Pi = en:pith
plant stemsplants
Jackfruits in Bulacan Averrhoa bilimbi Hall and Bisita ni San Agustin Roman Catholic Diocese of Malolos Barangays Tiaong 14°56'37"N 120°53'46"E Baliuag, Bulacan, Bulacan province (accessed from the C
plantsgreen
US Navy 070814-N-3038W-222 Overlooking the captain's chair on the bridge aboard Nimitz-class aircraft carrier USS John C. Stennis (CVN 74), USS Antietam (CG 54), USS Preble (DDG 88) and USS O'Kane (DDG 77) transit in formation
aboard uss o'kane (ddg-77)valiant shield 2007
US Navy 060104-N-2568S-002 Secretary of the Navy, the Honorable Dr. Donald Winter meets with Lance Cpl. Martin Roman and his mother, during a visit to see the wounded Sailors and Marines at National Naval Medical Center
donald c. winter in 2006wounded military people
Allegory of Spring with Flora, Vertumnus, and Pomona, France, c. 1600, wool - Hyde Collection - Glens Falls, NY - 20180224 120525
tapestries from franceself-published work
Anna Scoville Herrick by Sheldon Peck (1797-1868), c. 1828, oil on wood - Bennington Museum - Bennington, VT - DSC08505
self-published workcc-pd-mark
Amitabha Buddha, Pingdingzhou, Shanxi Province, China, Northern Qi or Sui Dynasty, c. 575-590 AD, marble - Royal Ontario Museum - DSC09819
bishop white gallery of chinese temple artamitābha statues
Astronomical regulator by Thomas Tompion, London, c. 1675-1685, used to observe the transit of Venus in Newfoundland, 1761 - Putnam Gallery - Harvard University - DSC07999
self-published workcc-pd-mark
Adirondack Guide by Winslow Homer, c. 1876, oil on panel - Hyde Collection - Glens Falls, NY - 20180224 121009
self-published workcc-pd-mark
Adoration of the Magi, by Johann Benedikt Witz, c. 1745-1750, linden wood - Mainfränkisches Museum - Würzburg, Germany - DSC04881
self-published workgold
Adrianna Hannaford, by Charles Octavius Cole, c. 1846, oil on canvas - Portland Museum of Art - Portland, Maine - DSC04071
self-published workcc-pd-mark
Cruciform watch, Giovanni Battista Mascarone, Milan, c. 1600 - Mathematisch-Physikalischer Salon, Dresden - DSC07895
self-published workcc-pd-mark
Classical forms, Chelsea Keramic Art Works, c. 1880, ceramic - Dedham Historical Society - Dedham Massachusetts - DSC04256
self-published workcc-pd-mark
Classical forms, Chelsea Keramic Art Works, c. 1880, ceramic - Dedham Historical Society - Dedham Massachusetts - DSC04257
self-published workcc-pd-mark
Coffee cup and saucer, Wedgwood Factory, England, c. 1860, stoneware - Montreal Museum of Fine Arts - Montreal, Canada - DSC09443
self-published workcc-pd-mark
Chiavenna Room, from Casa Moro, Chiavenna, c. 1580, maple, ash, walnut, other woods - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany - DSC00456
self-published workcc-pd-mark
Coffin's Beach at Sunset, by Fitz Henry Lane, c. 1862, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01211
self-published workcc-pd-mark
Collar, Ojibwa, c. 1890, glass beads, tin, velvet - Portland Art Museum - Portland, Oregon - DSC09146
indigenous art of the americas in the portland art museumself-published work
Christ upon the Donkey for the Palm Procession, Cologne, c. 1520, limewood and softwood, polychrome - Museum Schnütgen - Cologne, Germany - DSC00072
self-published workcc-pd-mark
14901 - 15000 of 34,298 Next page
/ 343