109,887 Free Images of Us

vehiclenavyshipaircraftmilitaryboataviationjetseaair force
US Navy 060624-N-7981E-073 Aviation Ordnancemen from Weapons Department, G-1 Division attach a cargo pendant to an MH-60S Seahawk assigned to Helicopter Sea Combat Two One (HSC-21)
militaryaircraft
US Navy 060906-N-4856C-005 Gunner's Mate Seaman Juntine R. Velayo from Las Vegas, Nev., prepares the salad bar in the Wardroom Mess aboard the amphibious assault USS Iwo Jima (LHD 7)
foodmeal
US Navy 061109-N-4965F-003 Engineman 1st Class Rafael Rangel, assigned to Explosive Ordnance Disposal Mobile Unit Three (EODMU-3), watches as two Pearl Kai elementary school students reach from a Mk-5 Rigid Hull Inflatable Boa
united states navy explosive ordnance disposalvehicle
US Navy 061117-N-8148A-078 Pakistani Naval Frigate Tippu Sultan (D 185) receives fuel from the Military Sealift Command (MSC) fast combat support ship USNS Supply (T-AOE 6) during an underway replenishment (UNREP)
navy1975
US Navy 070315-N-7130B-152 In a blur, an E-A-6B Prowler, assigned to the Cougars of Tactical Electronic Warfare Squadron (VAQ) 139, launches from the flight deck of USS Ronald Reagan (CVN 76) as ground crew member
aircraftvehicle
US Navy 070317-N-5961C-167 Sailors aboard USS Ronald Reagan (CVN 76) watch as four Japan Maritime Self Defense Force ships JS Myoko (DDG 175), JS Hamagiri (DD 155), JS Yuugiri (DD 153) and JS Haruna (DDH 141).
underway replenishmentnavy
US Navy 070317-N-5961C-137 USS Ronald Reagan (CVN 76) steams alongside Japan Maritime Self Defense Force (JMSDF) ships JS Hamagiri (DD 155), JS Myoko (DDG 175), JS Haruna (DDH 141) and JS Yuugiri (DD 153) in preparation for a f
vehiclesea
US Navy 070429-N-1328S-002 Sailors and Marines aboard the amphibious assault ship USS Boxer (LHD 4) man the rails as the ship pulls into Fremantle, Australia, for a port visit during their Western Pacific deployment
vehicleship
US Navy 070508-N-4856G-024 Adm. Robert F. Willard relieves Adm. Gary Roughead as Commander, U.S. Pacific Fleet (COMPACFLT) during the COMPACFLT change of command ceremony at Naval Station Pearl Harbor
male military people salutinggary roughead in 2007
US Navy 070506-N-6854D-004 An F-A-18C Hornet, from the Wildcats of Strike Fighter Squadron (VFA) 131, prepares to launch from the flight deck of Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69)
vehiclenavy
US Navy 070521-N-1082Z-005 Lt. Cmdr. John Fisher greets his wife and seven-month-old daughter at a flight line homecoming on Naval Station Norfolk after returning with the Rawhides of Fleet Logistics Support Squadron (VRC) 40
flight deck of uss dwight d. eisenhower (cvn-69)naval station norfolk
US Navy 070524-N-4420S-069 Aviation Boatswain's Mate 3rd Class Jerry Bickings taxies an E-2C Hawkeye, aboard USS Nimitz (CVN 68)
militaryvehicle
US Navy 060220-N-4776G-182 Helicopters deliver mail, food and other goods from the Military Sealift Command (MSC) combat stores ship USNS Niagara Falls (T-AFS 3) to the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76) d
boatsea
US Navy 060302-N-4772B-095 Sailors gives hand signals to move pallets from the Military Sealift Command (MSC) underway replenishment oilier USNS Yukon (T-AO 202)
aboard uss harpers ferry (lsd-49)signals (underway replenishment)
US Navy 060208-N-2832L-089 An SH-60F Seahawk helicopter assigned to the Golden Falcons of Helicopter Anti-Submarine Squadron Two (HS-2) recovers a Search and Rescue (SAR) swimmer from San Diego Bay
militaryvehicle
US Navy 060303-N-4772B-165 Marines assigned to the 31st Marine Service Support Group (MSSG) board a Landing Craft, Air Cushion (LCAC) bound for the amphibious dock landing ship USS Harpers Ferry (LSD 49)
air cushionvehicle
US Navy 060227-N-7359L-001 Sailors stationed aboard the Nimitz-class aircraft carrier USS Dwight D. Eisenhower (CVN 69) give a thumbs up as part of final checks for a C-2A Greyhound
aircraftvehicle
US Navy 060523-N-4614W-072 U.S. Army Spc. John Alden braces with his forward squad from Charlie Company, 1st Battalion, 327th Infantry Regiment, as a UH-60A Blackhawk arrives to extract them from a field outside Dugmat, Iraq
327th infantry regiment (united states)uh-60 black hawk
US Navy 070329-N-4965F-014 Master-At-Arms 1st Class Jinine Green and her military working dog, Malibu, a 2-year-old Jack Russell Terrier mixed breed, search for drugs during a training exercise on board Naval Station Pearl Harb
united states navy images from pearl harbormaster-at-arms
US Navy 070405-N-1810F-145 Gas Turbine System Technician (Mechanical) 1st Class Lee Mears attached to the guided-missile frigate USS Robert G. Bradley (FFG 49) enjoys the first kiss with his wife after returning from a six-mont
gas turbine systems techniciancelebrities
US Navy 070415-N-0555B-032 Racing past the flight deck of Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76), the pilot of an E-2C Hawkeye, assigned to the Black Eagles of Airborne Early Warning Squadron (VAW) 113 shows o
carrier airborne early warning squadron 113 (united states navy)northrop grumman e-2c hawkeye in flight
US Navy 070416-N-6501M-003 An MH-53E Sea Dragon assigned to Helicopter Mine Counter Measure Squadron (HM) 15 conducts a mine sweeping exercise with the Avenger-class mine countermeasure ship USS Gladiator (MCM 11)
boatsea
US Navy 070426-N-5484G-015 An F-A-18E Super Hornet assigned to the Tophatters of Strike Fighter Squadron (VFA) 14 and an F-A-18C Hornet assigned to the Sunliners of Strike Fighter Squadron (VFA) 81 prepare for launch
strike fighter squadron 81 (united states navy)f/a-18e super hornet on flight decks
US Navy 070119-N-5345W-068 An aviation boatswain's mate displays the weight board to the pilots of an E-2C Hawkeye
militaryvehicle
US Navy 070122-N-3729H-186 An aircraft flight deck director guides an E-2C Hawkeye assigned to the Golden Hawks of Carrier Airborne Early Warning Squadron One One Two (VAW-112) out of the landing area
northrop grumman e-2c hawkeye aircraft carrier landingsaboard uss john c. stennis (cvn-74)
US Navy 070126-N-4856G-045 Guided missile destroyer USS O'Kane (DDG 77) makes her way slowly through the harbor channel. O'Kane and USS Paul Hamilton (DDG 60) deployed as part of the USS John C. Stennis (CVN 74)
aboard uss john c. stennis (cvn-74)water
US Navy 070128-N-4776G-218 Connected by fuel hoses, Military Sealift Command (MSC) underway replenishment oiler USNS Yukon (T-AO 202) transfers JP-5 to USS Ronald Reagan (CVN 76) during a refueling at sea
general views of uss ronald reagan (cvn-76)vehicle
US Navy 070128-N-3729H-129 An SH-60F Seahawk assigned to the Eightballers of Helicopter Anti-Submarine Squadron Eight (HS-8) is directed to the landing area by a landing signalman enlisted
aircraftflight
US Navy 070207-N-8923M-016 Operations Specialist 3rd Class Jeana Mullen talks on a sound-powered telephone as Nimitz-class aircraft carrier USS Harry S. Truman (CVN 75) pulls alongside Military Sealift Command (MSC) dry cargo-a
boatship
US Navy 070207-N-8467N-003 Navy Diver 3rd Class Cory McDowell, attached to the Los Angeles-class fast attack submarine USS San Juan (SSN 751), swims through the icy Thames River
ice divingwater
US Navy 070912-N-7883G-025 Aviation Machinist's Mate Airman Jeromy Coleman wipes a wing of an E-2C Hawkeye, attached to the Liberty Bells of Carrier Airborne Early Warning Squadron (VAW) 115, aboard USS Kitty Hawk (CV 63)
aviation machinist's matee-2c hawkeye
US Navy 070917-N-5387K-025 Two F-A-18E Super Hornets, assigned to the Diamondbacks of Strike Fighter Squadron (VFA) 102, perform aerial maneuvers over USS Kitty Hawk (CV 63) during a practice air show
militaryvehicle
US Navy 071003-N-9898L-109 Rear Adm. Scott Van Buskirk, commander of Carrier Strike Group 9, and Capt. Patrick D. Hall, commanding officer of USS Abraham Lincoln (CVN 72), greet guests at a reception in Lincoln's hangar bay
victoria harbour (british columbia)group
US Navy 071006-N-3570S-023 The guided-missile frigate USS Vandegrift (FFG 48) enters the San Francisco bay as the lead ship for the Parade of Ships during the 27th annual San Francisco Fleet Week celebration
vehiclewater
US Navy 071027-N-7883G-050 Cmdr. Dan Dusek, commanding officer of USS Fitzgerald (DDG 62), exchanges business cards with Muroran Mayor Masashi Shingu during a reception held in the Japanese Steel Works reception hall
celebritiesgroup
US Navy 071104-N-8110K-003 Command Master Chief Sandra Huffman, assigned to the guided-missile destroyer USS Sampson (DDG 102), drops the ceremonial first puck
united states navy images from massachusettsuss sampson (ddg-102)
US Navy 071106-N-4133B-142 An F-A-18C Hornet, assigned to the Blue Diamonds of Strike Fighter Squadron (VFA) 146, launches off the flight deck of Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76)
vehiclejet
US Navy 070826-N-2659P-065 Flight deck personnel prepare to launch a C-2A Greyhound from the flight deck of Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) for the final time this deployment as the embarked Carrier A
fleet logistics support squadron 30 (united states navy)aboard uss john c. stennis (cvn-74)
US Navy 070824-N-0879R-005 A senior chief petty officer aboard Oliver Hazard Perry-class guided-missile frigate USS Reuben James (FFG 37) says goodbye to his family before departing for a Western Pacific deployment
united states navy images from pearl harboraboard uss reuben james (ffg-57)
US Navy 070827-N-0696M-073 Chief of Naval Operations (CNO) Adm. Mike Mullen is piped ashore at the conclusion of the change of office ceremony for Vice Adm. Donald C. Arthur, Surgeon General and chief of the Bureau of Medicine
male military people salutingnaval surgeons
US Navy 070828-N-7163S-008 (From left) Musician 3rd Class Joe Gacioch, Musician 3rd Class Justin Glenn, and Musician 2nd Class Ted Moore of Navy Band Great Lakes' rock band Horizon perform rock standards at
fort thomaskentucky
US Navy 070904-N-9758L-122 Sailors aboard Ticonderoga-class guided-missile cruiser USS Lake Erie (CG 70) man the rails as the ship returns home following a four-month deployment to the Western Pacific in support of the Navy^rsq
aboard uss nimitz (cvn-68)vehicle
US Navy 070903-N-9760Z-094 Sailors aboard nuclear-powered aircraft carrier USS Nimitz (CVN 68) participate in a replenishment at sea with Military Sealift Command fast-combat support ship USNS Rainier (T-AOE 7)
personnel at underway replenishmentwater
US Navy 120112-N-KD852-138 Marines assigned to the 11th Marine Expeditionary Unit (11th MEU) position themselves on the flight deck after fast ropi
eotech holographic sightsmales with m4 carbine
US Navy 110520-N-VF350-023 Navy Diver 2nd Class Joshua Westman sucks sand off the bottom of the ocean during a Joint POW-MIA Accounting Command (JP
joint pow/mia accounting commandunderwater
US Navy 110520-N-VF350-123 Navy Diver 2nd Class Jordan Wingard sucks sand off the bottom of the ocean during a Joint POW-MIA Accounting Command und
joint pow/mia accounting commandwater
US Navy 111029-N-DS193-014 A Sailor gives hand signals to the pilot of a C-2A Greyhound from the Providers of Fleet Logistics Support Squadron (VR
militaryvehicle
US Navy 100725-N-6003P-244 anding signal officers watch an F-A-18E Super Hornet assigned to the Gunslingers of Strike Fighter Squadron (VFA) 105) land aboard the aircraft carrier USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)landing signal officer
US Navy 100807-N-2821G-415 An E-2C Hawkeye launches off the flight deck of USS Abraham Lincoln (CVN 72)
militaryvehicle
US Navy 100810-N-9818V-019 The U.S. Navy Ceremonial Guard presents the colors at the Armed Forces Retirement Home during a dedication ceremony for an anchor
washingtonarmy
US Navy 110914-N-BT887-479 Sailors assigned to Explosive Ordnance Disposal Mobile Unit (EODMU) 11 rappels from an MH-60S Sea Hawk helicopter
militaryaircraft
US Navy 110922-N-RI844-133 A Bangladesh navy sailor fires a Type-56 assault rifle aboard the Bangladesh navy frigate BNS Bangabandhu (F 25) during
military2001
US Navy http-www.navy.mil-management-photodb-photos-100603-N-4236E-086 An F-A-18F Super Hornet prepares to catch the arresting cable aboard USS Dwight D. Eisenhower (CVN 69)
militaryvehicle
USS Duncan (FFG-10), USS Harold E. Holt (FF-1074) and USS Whipple (FF-1062) laid up at Pearl Harbor, Hawaii (USA), on 31 May 1996 (6495379)
watership
US Navy 091022-N-3038W-939 Aviation Ordnanceman aboard the aircraft carrier USS Nimitz (CVN 68) attach a cargo pendant to a MH-60S Sea Hawk helicopter assigned to the Wildcards of Helicopter Sea Combat Squadron (HSC) 23
militaryvehicle
US Navy 091023-N-9689V-007 Master Chief Petty Officer of the Navy (MCPON) Rick D. West high-fives a Sailor assigned to the guided-missile destroyer USS Preble (DDG 88) during a visit to the San Diego region
militarynavy
US Navy 091104-N-3038W-403 The guided-missile destroyer USS Sampson (DDG 102) trails the Military Sealift Command fast combat support ship USNS Bridge (T-AOE 10) and the aircraft carrier USS Nimitz (CVN 68)
boatsea
US Navy 091108-N-8913A-125 A T-45 Goshawk training aircraft assigned to the Tigers of Training Squadron (VT) 9 comes in for an arrested landing aboard the aircraft carrier USS Harry S. Truman (CVN 75)
aircraftvehicle
US Navy 091106-N-2953W-021 A Sailor activates his self-contained breathing apparatus during the Basic Shipboard Firefighting Course at Farrier Firefighting School
blue clothesmale
US Navy 080711-N-3659B-107 Sailors form a line for a foreign object damage walk-down on the flight deck of the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76) as the sun sets over the Western Pacific
oceansea
US Navy 080718-N-8467N-006 Capt. Kenneth M. Perry, right, and Captain Robert P. Burke shake hands after Perry reports to Rear Adm. Bruce E. Grooms, commander, Submarine Group Two, center, that he has been relieved by Burke as c
handshakes involving the militaryarmy
US Navy 080801-N-4774B-036 The guided-missile destroyer USS Milius (DDG 69) passes by the amphibious assault ship USS Tarawa (LHA 1) in San Diego Harbor as Tarawa departs to deploy for the Fuerzas Alidas PANAMAX 2008
fisheye imagesvehicle
US Navy 080815-N-5961C-006 Two SH-60 Sea Hawk helicopters deliver pallets of supplies to the aircraft carrier USS Ronald Reagan (CVN 76) from the Military Sealift Command fast combat support ship USNS Bridge (T-AOE 10)
sh-60 seahawkvehicle
US Navy 100703-N-4135M-366 Cmdr. Edward Heflin, Officer of the Swordsmen of Strike Fighter Squadron (VFA) 32 is sprayed down on the flight deck of the aircraft carrier USS Harry S. Truman (CVN 75) after a change of command cere
aboard uss harry s. truman (cvn-75)vehicle
US Navy 100714-N-5319A-078 Sgt. Michael Splitt, assigned to Special Purpose Marine Air Ground Task Force 24, returns from Salinas Beach, Peru in an amphibious assault vehicle
assault amphibious vehiclesvehicle
US Navy 100413-N-6138K-442 U.S. Marines assigned to Security Cooperation Marine Air-Ground Task Force (SC-MAGTF) and solders from the Senegalese Armed Forces conduct an Africa Partnership Station West joint physical training se
fitness trainingpeople
US Navy 100420-N-6676S-021 U.S. Coast Guard Machinery Technician 2nd Class David Moyer, left, demonstrates pat-down procedures on Gambia sailor Kanyi Nfanbo during a Basic Boarding Officer Course
united states navy images from the atlantic oceanfrisk
US Navy 100523-N-0413B-201 Navy Diver 2nd Class James Maxey, left, and Navy Diver 2nd Class Dicky Ellis, both assigned to Mobile Diving Salvage Unit (MDSU) 1, conduct post dive maintenance on a MK-3 diving helmet
joint pow/mia accounting commandunited states navy divers
US Navy 100528-N-3136P-207 An Italian Navy visit, board, search and seizure team returns to the Italian Navy offshore patrol vessel ITS Comandante Foscari (P-493)
shipsea
US Navy 100529-N-0413B-002 Members of Mobile Diving Salvage Unit (MDSU) 1 and Joint POW-MIA Personnel Accounting Command (JPAC) offload a zodiac after two hours of underwater recovery searches during a JPAC recovery mission in
waterboat
US Navy 100615-N-4971L-315 Sailors deployed aboard High Speed Vessel Swift (HSV 2) and members of the Nicaragua navy prepare to board a mock fishing vessel while conducting visit, board, search and seizure subject matter expert
vehiclewater
US Navy 100602-N-9123L-005 The guided-missile cruiser USS Shiloh (CG 67) receives assistance from the large harbor tugs USS Massapequa (YTB 807), left and USS Kittanning (YTB 787) while departing Commander, Fleet Activities Yok
boatship
US Navy 100217-N-1092P-080 Rear Adm. Victor G. Guillory, commander, U.S. Naval Forces Southern Command, speaks with Haitian patients receiving medical care aboard the Military Sealift Command hospital ship USNS Comfort (T-AH 2
aboard usns comfort (t-ah-20)people of haiti
US Navy 100312-N-7948C-033 Italian navy Lt. Cmdr. Marco Compasso, assigned to Africa Partnership Station (APS) West staff, speaks with a Ghanaian Sailor during a maritime domain awareness workshop aboard the amphibious dock lan
united states navy in sekondi-takoradiaboard uss gunston hall (lsd-44)
US Navy 070716-N-6086C-191 Adm. William J. Fallon Commander of U.S. Central Command salutes the Afghan honor guard on hand at the change of command ceremony for Combined Security Transition Command-Afghanistan (CSTC-A)
male military people salutingwilliam j. fallon
US Navy 070722-N-9421C-032 A volunteer from the Vietnamese Ministry of Health offers dental care products to a local child at a dental civic action program at Nai Hiem Dong Medical Station in support of Pacific Partnership 2007
united states navy images from nam trung bộ regionpeople of da nang
US Navy 070722-N-9421C-163 Gas Turbine System Technician (Mechanical) 2nd Class Mark Echelberger poses for a photo with local children on a newly built playground set at Hoi Mai Orphanage during an engineering civic action prog
united states navy images from nam trung bộ regiongas turbine systems technician
US Navy 080624-N-9671T-168 Korean sailors aboard the Republic of Korea Ship (ROKS) Yang Monchoon (DDH 973) wave to observers as the ship pulls into Pearl Harbor for the Rim of the Pacific (RIMPAC) 2008 Exercise
militaryboat
US Navy 080625-N-9818V-206 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. presents the graduates of the Western New York Maritime Charter School with their certificates during the first graduation commencement
new yorkjr
US Navy 080626-N-4009P-688 Aviation Warfare Systems Operator 2nd Class Anthony Chavez, of San Bernardino, Calif., looks over flooded areas in the Republic of the Philippines
helicopter anti-submarine squadron 4 (united states navy)humanitarian aid in the philippines
US Navy 080626-N-5961C-002 A member of the Philippine Army carries bottled water to a waiting helicopter assigned to Helicopter Anti-Submarine Squadron (HS) 4 at Iloilo airport
helicopter anti-submarine squadron 4 (united states navy)uss ronald reagan (cvn-76) humanitarian aid
US Navy 080627-N-0879R-003 Sailors man the rails as the amphibious assault ship USS Bonhomme Richard (LHD 6) pulls into Naval Station Pearl Harbor for a scheduled port call before starting Rim of the Pacific (RIMPAC) 2008
united states navy images from pearl harbor2008 in pearl harbor
US Navy 080629-N-5961C-015 Air crews assigned to Helicopter Anti-Submarine Squadron (HS) 4 have been working long hours for five days delivering food and water to Panay Island, Republic of the Philippines in the wake of Typhoon
helicopter interiorpeople
US Navy 100118-N-8822R-027 An MH-53E Sea Dragon helicopter assigned to the Blackhawks of Helicopter Mine Countermeasure Squadron (HM) 14 lifts off from the Nimitz-class aircraft carrier USS Carl Vinson (CVN 70)
militaryaircraft
US Navy 100119-N-6604E-034 An SH-60F Sea Hawk helicopter assigned to the Nightdippers of Helicopter Anti-submarine Squadron (HS) 5 transports pallets of supplies from the Military Sealift Command fast combat support ship USNS S
boatsea
US Navy 100127-N-3165S-071 An MH-60S Sea Hawk helicopter transfers pallets of meals-ready-to-eat from USNS Sacagawea (T-AKE-2) to USS Bataan (LHD 5)
mh-60s seahawkfly
US Navy 100126-N-0807W-014 The mine countermeasures ship USS Guardian (MCM 5) moors in dry-dock at SSK Shipyard in Sasebo, Japan during a scheduled dry-dock selective restricted availability
waterboat
US Navy 100128-N-2000D-305 Sailors aboard the amphibious dock landing ship USS Carter Hall (LSD 50) transfer pallets of food rations from Carter Hall to U.S. Army Landing Craft Unit 2001
boatsea
US Navy 100130-N-5961C-002 Workers remove debris from the Hotel Montana in Port-au-Prince, Haiti
port-au-princehotel montana
US Navy 100130-N-7948C-026 he U.S. Coast Guard Cutter Hamilton (WHEC 715), center, transits past the Military Sealift Command hospital ship USNS Comfort (T-AH 20)
boatsea
US Navy 100203-N-6676S-004 Capt. Cindy Thebaud, commander of Africa Partnership Station West, embarked aboard the amphibious dock landing ship USS Gunston Hall (LSD 44), welcomes Air Force Gen. Douglas Fraser
handshakes involving the militaryoperation unified response
US Navy 100308-N-7948C-260 Capt. Cindy Thebaud, commander of Africa Partnership Station (APS) West, tours a navigation simulator at the Joint Maritime Training Center at Nigeria Naval Station Quorra
ship bridge simulatorscynthia m. thebaud
US Navy 100307-N-0808V-597 The aircraft carrier USS Carl Vinson (CVN 70) performs tactical maneuvering exercises with the guided-missile cruiser USS Bunker Hill (CG 52) and the Uruguayan navy frigate Uruguay (ROU 1) during Sout
vehicleboat
US Navy 091114-N-0000X-003 Members of Mobile Diving and Salvage Unit (MDSU) 2, the Royal Navy and members of the Iraqi Defense Forces pose for a photo aboard the coastal patrol boat USS Firebolt (PC 10)
royal navypeople
US Navy 100223-N-6604E-112 Aviation's Boatswain's Mate (Equipment) 2nd Class Derrick Delhomme and Aviation Boatswain's Mate (Equipment) 2nd Class Kenneth London give a thumbs up to launch an F-A-18F Super Hornet
aviation boatswain's mateequipment
Alugbati vegetable Basella alba used in Utan Basella Malabar spinach Basella rubra L. with deep red and purple stems in Barangay Tukod 15°0'10"N 121°3'18"E Pulo 14°57'54"N 121°0'53"E beside Chapel 14
springplants
Alugbati vegetable Basella alba used in Utan Basella Malabar spinach Basella rubra L. with deep red and purple stems in Barangay Tukod 15°0'10"N 121°3'18"E Pulo 14°57'54"N 121°0'53"E beside Chapel 14
springplants
Alugbati vegetable Basella alba used in Utan Basella Malabar spinach Basella rubra L. with deep red and purple stems in Barangay Tukod 15°0'10"N 121°3'18"E Pulo 14°57'54"N 121°0'53"E beside Chapel 14
springplants
Alugbati vegetable Basella alba used in Utan Basella Malabar spinach Basella rubra L. with deep red and purple stems in Barangay Tukod 15°0'10"N 121°3'18"E Pulo 14°57'54"N 121°0'53"E beside Chapel 14
springplants
A European honey bee (Apis mellifera) extracts nectar from an Aster flower using its proboscis. Tiny hairs covering the bee's body maintain a slight electrostatic charge, causing pollen from the flowe
animalsspring
62201 - 62300 of 109,887 Next page
/ 1099