109,879 Free Images of Us

navyaircraftvehiclewatermilitaryaboard uss kitty hawk (cv-63)boatshipaboard uss harry s. truman (cvn-75)animals
US Navy 021116-N-3236B-011 USS Curtis Wilbur (DDG 54) participates in Exercise Keen Sword 03 off the coast of Southern Japan
shipsea
US Navy 021104-N-5862D-016 Students at the Aviation Rescue Swimmer School spend countless hours in the pool learning techniques to recover downed flight crew and personnel who have fallen overboard at sea
nas pensacolawater
US Navy 021002-N-2383B-527 Admiral Edmund P. Giambastiani, Jr. (right), receives the command flag during a change of command ceremony
change of command ceremonies of the united states navynaval station norfolk
US Navy 021127-N-1810F-012 A naval aviator assigned to the Gauntlets of Tactical Electronic Warfare Squadron One Three Six (VAQ-136)
militaryarmy
US Navy 021117-N-3236B-001 A final checker lines up the launch bar on an EA-6B Prowler
aircraftvehicle
US Navy 021209-O-0000X-009 Containers found to have scud missile parts in the cargo hold aboard the North Korean vessel, So San, discovered after being boarded by Spanish Special Forces
confiscated goodspiracy in somalia
US Navy 030217-N-1810F-003 An F-A-18C Hornet armed with the AIM-9M Sidewinder missile, stands ready for launch
militaryaircraft
US Navy 030217-N-1810F-002 viation Structural Mechanic 3rd Class Jonathan Ramiry from Miami, Fla., works on the tail rudder of an S-3B Viking aboard USS Kitty Hawk (CV 63)
aboard uss kitty hawk (cv-63)
US Navy 030226-N-1050K-023 Royal Marines from the 40th Commando unit load onto a Landing Craft Utility (LCU) following intensive training in the Kuwaiti Desert
landing craft utilityvehicle
US Navy 030326-N-7781D-033 On the Flag Bridge of USS Harry S. Truman (CVN-75) Rear Admiral John D. Stufflebeem, Commander Task Force Sixty (CTF-60)
aboard uss harry s. truman (cvn-75)john stufflebeem
US Navy 051105-N-9693M-005 U.S. Naval Academy Midshipman 2nd Class Matt Hall (34) carries the ball against the Tulane Green Wave defense
sport2005
US Navy 030322-N-2819P-011 Photographer's Mate 3rd Class Angel Roman-Otero photographs crewmembers aboard USS Kearsarge (LHD 3) for the ship's cruise book
people with camerasphoto shooting
US Navy 030327-N-3783H-169 Disarmed Iraqi mines confiscated during mine sweeping and interdiction operations by members of Commander Task Unit (CTU-55.4.3)
united states navy explosive ordnance disposalumm qasr in the iraq war
US Navy 060131-N-1194D-006 The Seventh Fleet Band's brass quintet Shonan Brass plays during a special goodwill concert
united states navy images from nagoyaaboard uss blue ridge (lcc-19)
US Navy 030329-N-1512S-008 Yeoman 2nd Class Christopher Chatman from Baton Rouge, La., leads the ship's Administrative Office Tug-of-War team
tug of warpeople
US Navy 030403-N-1810F-003 F-14A Tomcats fly in formation on final approach to USS Kitty Hawk (CV 63)
aircraftvehicle
US Navy 030401-N-1577S-002 Hull Technician 2nd Class David Chapa from Pleasanton, Texas, lines up his drill to begin installation of an electrical outlet aboard USS Nimitz (CVN 68)
aboard uss nimitz (cvn-68)people
US Navy 050311-N-2385R-012 Hospital Corpsman 2nd Class Lorenzo Branch, assigned to Branch Health Clinic Sasebo, Japan, applies antibiotic ointment on a patient's recently removed toenail to keep it from getting infected
united states fleet activities sasebo
US Navy 050309-A-0000V-002 U.S. Army Pacific Deputy Commander, Maj. Gen. Stephen Tom, center, and Deputy Chief of Staff for Plans and Programs, Maj. Gen. Romeo Alamillo, right, furl the Exercise Balikatan 2005 colors in prepara
balikatan 2005people
US Navy 050321-N-5328N-001 Crew members aboard yard-patrol boat YP702 make preparations to get the boat underway on board Naval Air Station (NAS) Pensacola, Fla
waterboat
US Navy 050330-N-9866B-004 Sailors stand in the hanger bay aboard the amphibious assault ship USS Peleliu (LHA 5) as it passes by the Nimitz-class aircraft carrier USS Ronald Reagan (CVN 76)
aboard uss ronald reagan (cvn-76)
US Navy 061124-N-3642E-001 Secretary of the Navy (SECNAV) The Honorable Dr. Donald C. Winter wishes thanks to Sailors and Marines stationed at Al Asad Air Base during an all hands call
donald c. winter in 2006al asad airbase
US Navy 061122-N-8148A-145 Aviation Machinist's Mate 2nd Class Paul St. Hill, assigned to
aviation machinist's matenavy
US Navy 061117-N-5307M-020 U.S. Navy Color Guard parade the colors at the opening ceremony of the Dignity Memorial Vietnam Wall at Mt. Trashmore Park
photographs of military flags of the united statescolor guards of the united states navy
US Navy 061207-N-0879R-018 Seaman 1st Class Clare Hetrick awaits the start of the joint U.S. Navy-National Park Service ceremony commemorating the 65th Anniversary of the attack on Pearl Harbor
65th anniversary of pearl harbor attackuss arizona survivors
US Navy 061212-N-8148A-019 A soldier assigned to Army 82nd Airborne Division stands by and observes as his personal belongings are searched and inspected by Customs Border Clearance Agent Mass Communication Specialist 3rd Class
mass communication specialistpeople
US Navy 061208-N-8158F-144 An E2-C Hawkeye assigned to the
aircraftvehicle
US Navy 061212-N-7571S-006 A T-45 Goshawk lands on board USS Theodore Roosevelt (CVN 71) during flight operations
aircraftvehicle
US Navy 061214-N-0696M-041 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks at the Historical Black College-University-Minority Institution Conference in New Orleans
michael g. mullen in 2006military in new orleans
US Navy 061210-N-4097B-007 Sailors assigned to Riverine Squadron One (RIVRON-1) conduct field and water exercises as part of their final evaluation prior to deployment
waterboat
US Navy 061221-N-5330L-271 Chief of Naval Operations (CNO), Adm. Mike Mullen speaks to junior officers aboard guided-missile cruiser USS Anzio (CG 68)
michael g. mullen in 2006celebrities
US Navy 050113-N-6363M-003 Sailors assigned to the Launch and Recovery Division in the Air Department, relax during a break in flight operations on the flight deck aboard USS Harry S. Truman (CVN 75)
aboard uss harry s. truman (cvn-75)
US Navy 050106-N-6074Y-112 USNS Rainier (T-AOE 7) supplies fuel to USS Mount Rushmore (LSD 47) during an underway replenishment
aboard uss rushmore (lsd-47)fueling-at-sea
US Navy 050113-N-6363M-032 An SH-60F Seahawk comes in for a landing aboard USS Harry S. Truman (CVN 75)
aircraftflight
US Navy 050124-N-1810F-598 An Iraqi local girl walks away from the side of a road where she received a lollipop by a passing American convoy
plant haulagetwin tires
US Navy 050203-N-3642E-008 The High Speed Vessel Two (HSV-2) swift prepares to be moored at the pier in Belawan, Indonesia
vehicleboat
US Navy 050203-N-XXXXX-001 Supply Corps, U.S. Navy Reserve, Lt. Cmdr. Keith Taylor from Irvine, Calif., was killed in a rocket attack on the U.S. Embassy Compound in Baghdad, Iraq, on Jan. 30, 2005
lieutenant commanders of the united states navy
US Navy 050120-N-2385R-005 First Class Petty Officers check their answer sheets prior to beginning the Chief Petty Officer Exam held at the Harbor View Club on board U.S. Fleet Activities Sasebo, Japan
united states fleet activities sasebo
US Navy 080813-N-8933S-140 Navy Diver 2nd Class Todd Walsh gives the okay to Navy Diver 3rd Class Levi Hughes
people1965
US Navy 080813-N-3595W-200 A U.S. Air Force medic gives medicine to a Nicaraguan girl during a Continuing Promise 2008 humanitarian assistance project
united states navy images from tuapicontinuing promise 2008
US Navy 080819-N-6936D-124 Sailors assigned to the amphibious assault ship USS Essex (LHD 2) work together to help a shipmate exit from a flooding space
aboard uss essex (lhd-2)damage control
US Navy 080816-N-8273J-221 Master Chief Petty Officer of the Navy (MCPON) Joe R. Campa Jr. speaks with Sailors during an all hands call at Bagram Air Force Base
joe r. campajr
US Navy 080827-N-9123L-001 Sailors approach the ship in an Australian Navy rigid hull inflatable boat
vehiclewater
US Navy 080830-N-1082Z-031 Sailors man the rails aboard the guided-missile cruiser USS Vella Gulf (CG 72)
manning the rail in the united states navywhite
US Navy 080908-N-7239B-003 Sailors man the rails as the aircraft carrier USS Theodore Roosevelt (CVN 71) is escorted out to sea after leaving Naval Station Norfolk
manning the rail on uss theodore roosevelt (cvn-71)naval station norfolk
US Navy 080909-N-0483B-005 Sonar Technician (Surface) 3rd Class James Garringer, from Bridgeville, Ind., paints a hatch on the fantail of the guided-missile cruiser USS Shiloh (CG 63)
yokosuka naval base in the 2000suss shiloh (cg-67)
US Navy 080913-N-4515N-517 Aircrew members assigned to the
beansack
US Navy 071223-N-7029R-024 Military family members play cards at the Naval Air Station North Island gym after being evacuated from their homes due to the wildfires throughout San Diego County
naval air station north island in the 2000s
US Navy 080111-N-8273J-016 Chief of Naval Operations (CNO) Adm. Gary Roughead tours Pacific Beacon, the Navy's first large-scale housing privatization facility for single Sailors
gary roughead in 2008people
US Navy 080122-N-0455L-157 viation Structural Mechanic 2nd Class James Flynn assigned to the
e-2c hawkeyepeople
US Navy 080203-N-0807W-437 Sailors aboard the amphibious assault ship USS Harpers Ferry (LSD 49) secure an SH-60 Seahawk helicopter to the flight deck
militaryvehicle
US Navy 080131-N-2143T-001 Sailors from Naval Base Kitsap practice turning and maneuvering in an empty parking lot at Naval Undersea Warfare Center (NUWC) Keyport as part of a two-day basic rider course
naval undersea warfare center keyport
US Navy 080218-N-5476H-162 Quartermaster 3rd Class Jason Tetreault plots the ship's position in the bridge as quartermaster of the watch aboard the Ticonderoga-class guided-missile cruiser USS Lake Erie (CG 70)
aboard uss lake erie (cg-70)
US Navy 080215-N-0807W-060 A rainbow breaks over Sailors mustering for an underway replenishment aboard the amphibious assault ship USS Harpers Ferry (LSD 49)
aboard uss harpers ferry (lsd-49)people
US Navy 080218-N-5476H-132 Quartermaster Seaman Jason Strom, a native of Brandon, Minn., attaches a signal flag to be hoisted up during a signaling drill between the guided-missile cruiser USS Lake Erie (CG 70)
uss decatur (ddg-73)
US Navy 080606-N-5366K-061 Basic Underwater Demolition-SEAL (BUD-S) students race out of the surf after completing the last exercise of Hell Week at Naval Special Warfare Center
basic underwater demolitions/sealnaval special warfare center
US Navy 080616-N-3674H-147 Seabees assigned to Naval Mobile Construction Battalion (NMCB) 74 install a door at a school in Holl Holl as part of a civic affairs project
united states navy images from ali sabieh regionholhol
US Navy 080622-N-1226D-086 oberto Olivares, a Peruvian sailor, paints school chairs during a community relations project during UNITAS 49-08
painters (artisans)spray paint
US Navy 080626-N-9689V-002 Members of the Pacific Fleet Dixie Band, embarked aboard the Military Sealift Command hospital ship USNS Mercy (T-AH 19), perform for patients
aboard usns mercy (t-ah-19)people of nha trang
US Navy 080703-N-1424C-798 Seabees assigned to Amphibious Construction Battalion (ACB) 1 reconstruct the deck of a platform overlooking Red Beach
beaches of marine corps base camp pendletonjoint logistics over the shore
US Navy 080703-N-7668G-012 The attack submarine USS Norfolk (SSN 714) is moored at Naval Station Norfolk after returning from a scheduled deployment
waterboat
US Navy 080703-N-3271W-072 Aviation Structural Mechanic Equipment 2nd Class Peter Vonszilassy, right, special warfare coordinator with the SEAL Accelerator, competes with a civilian patron
virginiasalem
US Navy 080713-N-3946H-009 Quartermaster 3rd Class Matthew Lenerville, from Richardton, N.D.,
signals (underway replenishment)aboard uss kitty hawk (cv-63)
US Navy 080711-N-8848T-202 Vice Adm. Mark E. Ferguson III, Chief of Naval Personnel and Deputy Chief of Naval Operations for Manpower, Personnel, Training and Education, salutes as he
uss midway ceremonial drill hallmark e. ferguson iii
US Navy 080712-N-1082Z-003 Sailors on a rigid hull inflatable boat participating in small boat operations return to the guided-missile destroyer USS Ramage (DDG 61)
vehiclewater
US Navy 080716-N-6764G-324 Yeoman 2nd Class Henry Gauthier inspects Sailors' uniforms aboard the amphibious transport dock ship USS San Antonio (LPD 17)
aboard uss san antonio (lpd 17)yeoman (united states navy)
US Navy 080722-N-5366K-347 Freefall parachute jumpers leap from a C-130 at 12,500 feet over San Diego as part of their regular training cycle
paratrooperrock
US Navy 080721-N-0260R-065 Gunner's Mate 3rd Class Christina Lozano renders aid to casualty role players
united states navy images from pearl harborgunner's mate
US Navy 080808-N-7730P-070 Chief Store Keeper Ronald Cruz and Midshipman Danielle Chlopek attach a sling to an HH-60H Seahawk assigned to the
militaryvehicle
US Navy 080815-N-7498L-011 Papua New Guinea Prime Minister the Right Honorable Sir Michael Somare speaks with a patient
aboard usns mercy (t-ah-19)group
US Navy 070930-F-9074R-104 A group observes the work done by a U.S. Navy Mobile Construction Battalion during a tour of the Combined Joint Task Force-Horn of Africa project
architecturepeople
US Navy 070927-N-1522S-001 Sailors listen to a taped video presentation from Chief of Naval Personnel Vice Adm. John Harvey Jr. at the Task Force Life Work Roadshow held on board Naval Station Mayport
people at naval station mayport
US Navy 070927-N-4267W-154 A Seabee with Naval Mobile Construction Battalion (NMCB) 7 negotiates through a mud filled trench during a jungle warfare training evolution hosted by Marines with the Jungle Warfare Training Command
males with m16 riflecamp gonsalves
US Navy 070930-F-9074R-017 A group observes the work done by a U.S. Navy Mobile Construction Battalion during a tour of the Combined Joint Task Force-Horn of Africa project
united states navy images from seychellesla digue
US Navy 071109-N-6597H-306 Aviation boatswain's mates prepare to transport a simulated causality to the medical department aboard amphibious assault ship USS Tarawa (LHA 1) during firefighting training
aviation boatswain's mateaboard uss tarawa (lha-1)
US Navy 071114-N-5928K-002 Aviation Ordnanceman 3rd Class Michael Parks, left, and Aviation Ordnanceman Airman Matthew Ferguson attach the fin to a guided bomb unit (GBU) 12
aviation ordnancemangbu-12
US Navy 071115-N-0193M-150 Nigerian Lt. A.S. Omotosho practices restraining suspects with the help of Coast Guard Chief Boatswain's Mate Anthony Cirillo
architecturepeople
US Navy 071113-N-7883G-009 Aviation Electronics Technician 3rd Class Michael Smith presses uniforms in the laundry facility aboard aircraft carrier USS Kitty Hawk (CV 63)
aviation electronics technicianaboard uss kitty hawk (cv-63)
US Navy 071124-N-0780F-001 The Los Angeles-class nuclear-powered submarine USS Montpelier (SSN 765) arrives in Souda Harbor for a routine port visit
watership
US Navy 071126-N-3136P-039 Helicopter Anti-Submarine Squadron (HS)14 Sailors stand on the bow aboard the aircraft carrier USS Kitty Hawk (CV 63) for a group photograph
militaryaircraft
US Navy 071128-N-8132M-010 Sailors assigned to the No. 1 hose team fight a simulated fire during a general quarters drill on the flight deck of the nuclear-powered aircraft carrier USS Enterprise (CVN 65)
aboard uss enterprise (cvn-65)people
US Navy 071201-N-9623R-017 A member of Naval Mobile Construction Battalion (NMCB) 17 ensures that constantine wire is secure in place and at the right height from the ground
naval mobile construction battalion 17fort hunter liggett
US Navy 071207-N-0807W-012 First and second-graders from Sasebo Elementary School, with the help of the United Service Organizations (USO), bake holiday cookies for Sasebo's single Sailors
united service organizations in the 2000sunited states navy images from sasebo
US Navy 070910-N-0989H-020 A Dominican port security officer prepares to present a risk analysis matrix for response to hurricanes, during port security training
dominican republic2007
US Navy 070920-N-6889J-054 Seabees attached to Naval Mobile Construction Battalion (NMCB) 74 participate in a two-mile force march at the Naval Construction Battalion Center
naval mobile construction battalion 74army
US Navy 070921-N-0696M-322 Chief of Naval Operations (CNO) Adm. Mike Mullen speaks at the Naval Post Graduate School (NPS) commencement ceremony
naval postgraduate schoolmichael g. mullen in 2007
US Navy 070920-N-4014G-091 Members of the visit, board, search and seizure team aboard guided-missile destroyer USS Porter (DDG 78) are briefed prior to conducting an exercise
vessels of the united states sixth fleetaboard uss porter (ddg-78)
US Navy 070921-N-5328N-701 Officer Candidate School Class 20-07, the last class of officer candidates to graduate from Officer Training Command Pensacola, receive their commission during a ceremony held at the National Museum o
national naval aviation museum
US Navy 070926-N-0841E-035 Team members of the visit, board, search and seizure team assigned to guided-missile frigate USS Carr (FFG 52) prepare to visit to a fishing dhow as part of an interaction patrol
boatnavy
US Navy 070922-N-0879R-008 Guided-missile destroyer USS Chafee (DDG 90) returns to port after a scheduled deployment
militarynavy
US Navy 050526-F-5586B-058 U.S. Navy medical personnel provide medical assistance to a simulated patient during exercise Lifesaver 2005 at Pensacola Naval Air Station. Military personnel join local, state and federal agencies i
medicine at nas pensacola
Enormous cacti, silhouetted by the setting sun, for most of us the Giant Sauraro is the universal symbol of the American West. And yet, these majestic plants are only found in a small portion of the U
animalsmammals
Quiscalus quiscula - The Common Grackle. A hefty gracklesk foot befitting the beast. All photographs are public domain, feel free to download and use as you wish. Photography Information: Canon
animalsbird
Heermann's Gulls You are free to use this image with the following photo credit: Peter Pearsall/U.S. Fish and Wildlife Service
animalsbird
Common murres sitting on floating ice near Cape Lisburne, Alaska. Eggs from this species are being used to monitor the cycling of mercury in the Arctic biosphere. See also www.nist.gov/mml/hml/eggs_01
animalsbird
I created this image myself on April 3rd 2009, using a flatbed scanner. Invertzoo (talk) 21:36, 3 April 2009 (UTC) This carapace of the rock crab Cancer irroratus was found on the beach at Long Beach,
arthropodadecapoda
Музей военной техники "Оружие Победы". Парк культуры и отдыха имени 30-летия Победы, Краснодар. The Russian Museum Law, article 36, restricts anyone from: using images of museum objects and coll
torpedoes of the soviet unionkrasnodar
US Navy 100116-N-7508R-031 Sailors aboard the multi-purpose amphibious assault ship USS Bataan (LHD 5) load supplies after getting underway from Morehead City, N.C
aboard uss bataan (lhd-5)military forklifts
US Navy 100118-N-9327W-016 Sailors aboard the amphibious assault ship USS Nassau (LHA 4) prepare to man the rails before the ship departs Naval Station Norfolk
manning the rail in the united states navyaboard uss nassau (lha-4)
US Navy 100119-N-6889J-046 Seabees assigned to Naval Mobile Construction Battalion (NMCB) 7 prepare civil engineer support equipment for shipment to Haiti
mississippimilitary
43601 - 43700 of 109,879 Next page
/ 1099