30,081 Free Images of King

cc-zerofiles uploaded by daderotanimalswhitecc-pd-markauthor died more than 100 years ago public domain imagesvehiclewildlifeplayingcat
Head of an Oba (king), Edo (Nigeria), court of Benin, 16th century AD, mixed copper alloy - Fogg Museum - Harvard University - DSC01862
sculpture in the fogg art museumself-published work
Ball headed club, owned by Swedish King Charles XV, probably contemporary copy of an original from New Sweden - Etnografiska museet - Stockholm, Sweden - DSC01213
self-published workcc-zero
Westland Sea King Mk.48 Belgium - Air Force RS04 pic8
militaryvehicle
Westland Sea King Mk.48 Belgium - Air Force RS04 pic2
militaryvehicle
Tröja, Gustav II Adolf - Livrustkammaren - 85231
jacketshirt
Recover rest pause boredom
wildlifeanimals
King Charles II (1630–1685), Peter Lely, circa 1675
male portraits by peter lelybaroque painting
Castle nymphenburg castle nymphenburg
watertree
King William III - Temple of British Worthies, Stowe - Buckinghamshire, England - DSC08476
self-published workarchitecture
King Wilhelm I von Wurttemberg, artist unknown, Stuttgart, 1841, papier mache - Landesmuseum Württemberg - Stuttgart, Germany - DSC03282
self-published workcc-pd-mark
Standing Tenno (Deva King), Heian period, 12th century, wood with polychromy - Tokyo National Museum - DSC05084
self-published workcc-pd-mark
Portrait of Augustus II the Strong, c. 1714-1720, Meissen, modeled by Johann Joachim Kretzchmar, Bottger porcelain, enamel, gold, silver gilding - Gardiner Museum, Toronto - DSC00750
böttgerporzellancc-zero
Wat Suwan Dararam wihan - inside - 2017-02-13 (059)
self-published workcc-zero
Wat Suwan Dararam wihan - inside - 2017-02-13 (060)
self-published workcc-zero
30 Shillings, Charles I, England, date unknown - Bode-Museum - DSC02765
self-published workgold
President Ronald Reagan with Carol Burnett and Carrie Hamilton in the receiving line during the State Visit of King Birendra Bir Kikram Shah Dev of Nepal in the East Room
celebritiesgroup
SH-3D HS-75 on USS Eisenhower (CVN-69) 1985
vehiclenavy
SH-3H HS-17 and AIM-9Ls on deck of USS Coral Sea (CV-43) 1986
operation attain document (1986)aboard uss coral sea (cv-43)
Westland Sea King Mk.48 Belgium - Air Force RS04 pic5
militaryvehicle
US Navy 080121-N-8547M-055 Culinary Specialist 3rd Class Jesus D. Fimbres, assigned to Naval Mobile Construction Battalion (NMCB) 5, cooks vegetables for the Martin Luther King Jr. memorial dinner
culinary specialist (united states navy)naval mobile construction battalion 5
US Navy 100125-N-7939W-024 John W. Miller, commander of Carrier Strike Group (CSG) 11, addresses sailors during a celebration honoring the Rev. Dr. Martin Luther King Jr. aboard the aircraft carrier USS Nimitz (CVN 68)
aboard uss nimitz (cvn-68)architecture
US Navy 070416-N-4790M-002 Maj. Jocelyn King, Royal Australian Army, discusses plans with Helicopter Anti-Submarine Squadron 10 aircrew men before embarking on a flight to administer medical aid
united states navy images from the solomon islandspeople of the australian army
On a Specimen of the Extinct Dromceus ater discovered in the Royal Zoological Museum, Florence. THE IBIS, QUARTERLY JOURNAL OF ORNITHOLOGY. VOL. I. Eighth Series 1901.
animalsbird
Big cat dangerous wildcat
wildlifeanimals
Big cat dangerous wildcat
wildlifeanimals
Roll the dice cards playing cards
heartking
King Ashurnasirpal II, Nimrud, Northwest Palace chamber G, slab 13, view 1, Neo-Assyrian period, reign of Ashurnasirpal II, 883-859 BC, alabaster - Oriental Institute Museum, University of Chicago - DSC07482
ashurnasirpal ii reliefs in the oriental institute museumself-published work
King Gustaf VI Adolf in 1967 OLM-2012-8-6744
peoplecity
King Gustaf VI Adolf in 1965 OLM-2012-8-1148
monochromepeople
King Gustaf VI Adolf in 1965 OLM-2012-8-1153
monochromepeople
King Gustaf VI Adolf in 1965 OLM-2012-8-1149
monochromepeople
King Gustaf VI Adolf in 1965 OLM-2012-8-1405
monochromepeople
Detaljbild på mönster, Gustav II Adolfs dräkt från Kleinwerder år 1627 - Livrustkammaren - 5353
male clothingshirt
President Ronald Reagan, Nancy Reagan, Queen Noor, and King Hussein I
nancy reagan in 1981d.c.,
President Ronald Reagan and Nancy Reagan greet King Hussein I and Queen Noor
nancy reagan in 1981d.c.,
Intaglio Caracalla Cdm Paris Chab2101
purpleparis
Apogon imberbis en El Portús (Cartagena, Spain)
underwatermarine
US Navy 050405-N-0357S-006 Australian service members, Indonesian police officers and U.S. Navy aircrew men carry an injured Royal Australian Navy Sailor to an awaiting Australian C-130 Hercules aircraft
united states navy images from niaspeople
Around Southern Pacific's San Francisco Terminal in March 1985 -- 9 Photos (30931580326)
vehiclecar
STILT BIRDS LIVE PROTECTED IN KANAHE POND, IN A CONSERVATION DISTRICT SURROUNDED BY AN URBAN AREA. THE POND WAS MADE MORE THAN 200 YEARS AGO BY KING KANEHAMEHA THE GREAT AS A ROYAL FISH POND. THE STIL
animalsbird
Real mountains swedish mountains snow
landscapewinter
Recover rest pause boredom
wildlifeanimals
Adoration of the Three Kings, Joseph Forti, c. 1700, ivory - Hessisches Landesmuseum Darmstadt - Darmstadt, Germany -DSC00548
self-published workcc-pd-mark
Kudduru (cast from British Museum), 11th century BC, recording grant of land by Marduk-nadin-ahhe, King of Babylon, to Adad-zer-iqisha - Oriental Institute Museum, University of Chicago - DSC07026
self-published workcc-zero
Naresuan life - Wat Suwan Dararam - Section 15 (2147 BE)
self-published workextracted images
Former Three Counties Church, Kings Road, Haslemere (June 2015) (3)
self-published workhaslemere
Grande Brasserie de la Croix de Lorraine - Musée Européen de la Bière - beer advertising posters -034 (cropped)
extracted imageswith trademark
Death of Titus Tatius, King of the Sabines, by Januarius Zick, c. 1755 - Mainfränkisches Museum - Würzburg, Germany - DSC04625
self-published workcc-pd-mark
Batman Park Helipad 20180723-003
skylinecity
Kings crown
princecrown
Edward VI granting the Royal Charter to Bridewell Hospital, George Vertue, 1750
portrait paintings of edward vi of englandpaintings by george vertue
The Battle of Somah, Horace Vernet, 1839
battle paintings by horace vernetromanticism
Isolated 3d model
trainking
Isolated 3d model
trainking
Isolated 3d model
trainking
Isolated 3d model
trainking
Lion Polygonal Colorful Mosaic Portrait
animalsafrica
African cat wild
animalsnature
Isolated 3d model
trainking
Portrait of King James II of England and VII of Scotland (by Studio of Sir Godfrey Kneller)
portrait paintings by godfrey kneller (british royalty)sash of the order of the garter in portrait paintings
King James II and VII (1633-1701)
ceremonial robes of the order of the garter in portrait paintingscircle of godfrey kneller
King Charles IX of France (by François Clouet)
male fur clothing in artlynx (clothing) in art
King Karl XII of Sweden (David von Krafft) - Nationalmuseum - 20352
portrait paintings of standing men with right hand on hipportrait paintings of charles xii of sweden
Rey Fernando III
globus cruciger in artkings in art
The Royal Feast of Belshazzar Blaine and the Money Kings (1884) alt
plutocracy1884
Anoniem (Noordelijke Nederlanden) - Portrait of James I (1566-1625), King of England - 105 - Mauritshuis
golden inscriptions in portrait paintings17th-century portrait paintings of men
Vernet - 31 juillet 1830 - Louis-Philippe quitte le Palais-Royal
french revolution of 1830louis philippe
Ludwig XII. von Frankreich
16th-century oil portraits of men at bust lengthlouis xii
Jean-Louis-Ernest Meissonier - The Portrait of a Sergeant - WGA14740
1870s paintings from francemilitary art
King William III by Jan de Baen
portrait paintings of william iii of englandlondon
Kings of the Visigoths by Alonso Cano
paintings of sitting menoil portraits of men
King George V 1911 color-crop
luke fildesgeorge v
Gustav IV Adolf, king of Sweden (Niclas Lafrensen d.y.) - Nationalmuseum - 133132
18th-century round portraits of menniklas lafrensen
François Clouet - Portrait of Francis I, King of France - WGA5075
16th-century equestrian portraits of men1540s paintings from italy
Antoine d'Orleans, Duc de Montpensier, 1844
copies of 19th-century portrait paintingslouis philippe
Prince Antoine of Orleans, Duke of Montpensier by Winterhalter (Real Alcázar de Sevilla)
19th-century oil portraits of standing men at full length in military uniformsalcázar of seville
Jean Baptiste Marie Pierre - Diomedes King of Thrace Killed by Hercules and Devoured by his own Horses, 1752
18th-century paintings of people with horsesheracles wearing nemean lion fur skin
Portrait of King Vittorio Amedeo III (10)
18th-century oil portraits of standing men at three-quarter length in ceremonial clothingermine (clothing) in art
Andrés de la Calleja (copiando el original de Mengs) - Retrato de Carlos III - Google Art Project
copies of 18th-century portrait paintingspaintings after anton raphael mengs
Charles XIV of Sweden painted by Fredric Westin
star of the order of the seraphim in portrait paintingsgärdet
Karl den XII, 1682-1718, king of Sweden (Axel Sparre) - Nationalmuseum - 15793
18th-century portrait paintings in the nationalmuseum stockholmportrait paintings of charles xii of sweden
Karl XIV Johan, king of Sweden and Norway, painted by Fredric Westin
1810s military uniformsfringed epaulettes
Princess crown
jewelleryprincess
JCCalhoun-1822, Charles Bird King
paintings of john calhounromanticism
King Ludwig II of Bavaria in general's uniform with the coronation cloak, Ferdinand von Piloty, 1865
ludwig ii of bavaria with coronation mantle (ferdinand von piloty)richard wagner
Apollo and two Muses, Pompeo Batoni, circa 1741
paintings by pompeo batoni in the wilanów palaceclassicism
Catherine of Aragon (1485-1536), Lucas Horenbout, 1525 2018-04-22
portraits of catherine of aragonlucas horenbout
Coral snake oriental
backgroundanimals
USS Carpenter (DD-825) and SH-3A of HS-2 with Soviet submarine in the Sea of Japan 1964
black and whitemonochrome
Sunrise, with bicitaxi parked below of palm tree. View over the Río Macaguanigua and the Boca Miel.
plantstree
A Royal Thai Army soldier from 2nd Battalion, 15th Infantry Regiment demonstrates how to catch a King Cobra snake as Army soldiers assigned C/Company, 1st Battalion, 501st Parachute Infantry Regiment,
animalspeople
Mug or caudle pot with King Charles II, Lambeth or Southwark, London, England, 1663, tin-glazed earthenware, HD 63.146 - Flynt Center of Early New England Life - Deerfield, Massachusetts - DSC04376
self-published workcc-zero
Former Wesleyan Chapel (1843), Kings Road, Shalford (May 2014) (3)
self-published workarchitecture
King Ashur-nasir-pal II and a Winged Genie - Room H, Northwest Palace, Nimrud (Kalhu), Iraq, Neo-Assyrian Period, reign of Ashur-nasir-pal II, c. 883-859 BC, alabaster - Brooklyn Museum - Brooklyn, NY - DSC08618
ashurnasirpal ii reliefs in the brooklyn museumself-published work
Isuzu N-Series. Refrigerated box rigid truck. Spielvogel 2013
vehiclecar
Shelter opposite Preston Street, King's Road, Brighton (NHLE Code 1381649) (July 2010)
19th-century architecture in east sussexself-published work
Former Three Counties Church, Kings Road, Haslemere (June 2015) (1)
building structurehaslemere
Book, bestowing title of Tho Xuan Quan Vutong to Hoang than Mien Dinh by King Tu Duc, 1878, copper - Museum of Vietnamese History - Ho Chi Minh City - DSC05955
self-published workmetal
Book, posthumously bestowing title of Duke of Phu Binh to Nguyen Phuc Mien Ao by King Tu Duc, 1865, copper - Museum of Vietnamese History - Ho Chi Minh City - DSC05954
self-published workmetal
Achille parmi les filles du roi Lycomède - Musée du Louvre - AGER Ma 2120
template unknown (author)self-published work
9501 - 9600 of 30,081 Next page
/ 301