34,524 Free Images of Hold

cc-zeroloveermine (clothing) in artwhiteanimalsmanfemalehappyflowerperson
Arthur von Ferraris Portrait einer Dame 1910
portrait paintings of women holding flowers1910s dresses
Luycx Ferdinand III Habsburg
holy roman emperorwarsaw
Hans Besser 006
frederick iimale
Bonifacio de Pitati - Virgin and Child with Saints - WGA02426
16th-century religious paintings in italy1520s paintings from italy
Jan van Kessel (II) or Claudio Coello (Attr.) - Portrait of Maria Anna of Neuburg
portrait paintings of women holding handkerchiefsjan van kessel (ii)
1706 - Antoine I Grimaldi (Monaco)
antoineantonio
Charles II as child portrait by Anthony van Dyck 1637
17th-century oil portraits of standing boys at full lengthlondon
Giovanni Battista Moroni 008
facing leftmale
Santi di Tito - Portrait of Mary of Medici
portrait paintings of women holding handkerchiefs16th-century oil on canvas paintings
Godfrey Webster Gauffier
battle abbeyfacing right
Tiepolo - Carlos, Prince of Asturias
ermine (clothing) in artfur fashion in 1763
Marijona Chmara
columns on pedestals in portrait paintingsfemale
Clemens August von Bayern - Peter Jacob Horemans
18th-century portrait paintings in germanycolumns on pedestals in portrait paintings
Chernyshev by Franz Krüger
columns on pedestals in portrait paintings1850s military uniforms
Aleksander Jan Jabłonowski
portrait paintings of men holding ceremonial macegreen drapery in portrait paintings
Paul Beckert Mädchen mit Buch 1911
girl's shoesfemale
Álvaro Drake, marqués de Villablanca, por José Moreno Carbonero
portrait paintings of standing men with left hand holding hatsportrait paintings of men holding firearms
Pesne - Queen Elisabeth Christine of Prussia, wife of King Friedrich II
female portrait paintings by antoine pesneermine (clothing) in art
Workshop of Jean Marc Nattier Louis Philippe d'Orleans, Duke of Orleans (Circa 1752–66)
18th-century oil on canvas paintingslouis philippe
William III, when Prince of Orange - Wissing 1685
17th-century oil portraits of standing men at three-quarter length in armourportrait paintings of william iii of england
Edward Vernon by Thomas Gainsborough
colombialondon
Maria Theresia im Hermelinumhang Österreich 18Jh
ermine (clothing) in artartist
Lavinia Fontana - Autoritratto (ca. 1577-85)
16th-century oil portraits of women at half lengthfacing left and looking at viewer
Joseph-Désiré Court - Portrait of Yekaterina Scherbatova - WGA5529
portrait paintings of women holding flowersfemales with white dresses in art
Clementi and Studio - Charles Emmanuel III of Sardinia in Royal Mantle
portrait paintings of standing men with right hand holding objects1750s oil on canvas paintings in the united kingdom
Gabriel Falkenberg af Sandemar, 1646-1714 (David Klöcker Ehrenstrahl) - Nationalmuseum - 15352
attributed portrait paintingsdavid klöcker ehrenstrahl
William Bentinck, 1st Earl of Portland by Hyacinthe Rigaud
portrait paintings with natural backgroundlondon
Sant Jaume i Sant Gil Abat, Joan Reixac, Museu de Belles Arts de València
paintings of christian saints holding croziers15th-century paintings of christian saints
Johann Jakob Griesbach c1800
19th-century portrait paintings of menfacing right and looking at viewer
CatherineI
columns on pedestals in portrait paintingsartist
Jacques de Trobriant, chef d'escadron des chasseurs à cheval de la Jeune Garde
anonymous 19th-century paintings from france1813 portrait paintings of men
Jacob Cornelisz. van Oostsanen - Portrait of a Man - WGA05264
portrait paintings of men wearing black beretschevrons gules
King Carlo Alberto
ermine (clothing) in artartist
Ernest Amadej Tomaž Attems (3)
ermine (clothing) in artartist and year missing
Anders Zorn - Hugo Reisinger
portrait paintings of bearded menanders zorn
Samuel Hood, 1st Viscount Hood by Lemuel Francis Abbott
portrait paintings of men holding tricorne hatslondon
Peter Paul Rubens 138
carmelitespain
Cool grass green
naturegrass
Love wedding romance
celebritiestree
Isolated christmas 3d model
christmasfood
Flower close up macro
animalsfood
Eeling Chiu holding Mipro microphone 20160120
amnesty international2016 events in taipei
US Navy 100917-N-1906L-007 MSRON 7 holds change of command ceremony
change of command ceremonies of the united states navymaritime expeditionary security squadrons
US Navy 110129-N-3374C-191 Sailors hold a line during rigid-hull inflatable boat training operations aboard USS George H.W. Bush (CVN 77)
aboard uss george h. w. bush (cvn-77)
US Navy 100825-N-2888Q-001 Builder 1st Class Damian Warner holds the tent flap open as Sailors from NAVELSG Lima Rotation enter the confidence chamber
naval weapons station yorktownbuilder (united states navy)
US Navy 100831-N-2908M-006 Fire Controlmen lower a sea sparrow holding unit to the deck of amphibious assault ship USS Kearsarge (LHD 3) during a missile loading evolution
aboard uss kearsarge (lhd-3)navy
US Navy 110918-N-KB563-180 Lt. Cmdr. Karl Haywood holds his daughter as Explosive Ordnance Disposal Group (EODGRU) 1 returns to Naval Air Station N
naval air station north island in the 2010speople
US Navy 100917-N-1906L-003 MSRON 7 holds change of command ceremony
change of command ceremonies of the united states navymaritime expeditionary security squadrons
A photograph of a man, photographing a poppy (Papaver rhoeas).
plantsgrass
Winona District Wildlife Refuge Specialist Brian Pember holds a great blue heron nest from a nesting tree that fell down. CREDIT: FWS – Stefanski
animalsbird
An unidentified man holding a leopard cub. An unidentified young boy is petting the cub. The photograph was taken in India by the United States Information Service (USIS).
animalsmammals
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a Alopochen aegyptiaca (left) and Vanellus armatus (right)
animalsbird
US Navy 091204-N-0209M-001 Family members and friends hold up signs as USS Wayne E. Meyer (DDG 108) arrives at its new homeport of San Diego
aboard uss wayne e. meyer (ddg-108)
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a flower.
plantsflower
SUNTORY HOLDINGS LIMITED HEADQUARTER
skylinecity
Children in Ribat-i-Abbasi of Nishapur (Hossein - Ali - Fatemeh - Hengameh and another girl - probably Afghani) 34
afghan diaspora in iranself-published work
Children in Ribat-i-Abbasi of Nishapur (Hossein - Ali - Fatemeh - Hengameh and another girl - probably Afghani) 32
afghan diaspora in iranself-published work
Cool grass green
animalsnature
Girl Holding a Video Game Controller
girlface
Man shopping
shoppingbag
Wedding Cake ceremony spark
celebritiesfood
Father baby daughter
naturesummer
A female holding an iPhone X and taking notes 3
technologytools
Bride celebration dress
healthnature
Girls wedding venue enjoyment
weddingmother
Dad daddy family
fathermale
Using technology business
technologybusiness
Book candid casual
malebook
Women hand in hand woman
peoplehuman
Family child love
motherfamily
Pen handwriting school
schoolhuman
Fossil in La Guardia beach
la guardia beachhold
Joint Base Pearl Harbor Hickam Morale, Welfare and Recreation Holds 4th of July Celebration Event 150704-N-ON468-048
sport2015
Jefferson Memorial (33637344720)
militaryd.c.,
Man speaks to law enforcement explorers at National Law Enforcement Officers Memorial
peopled.c.,
US Navy 111205-N-FI736-008 Sailors aboard the Arleigh Burke-class guided-missile destroyer USS Porter (DDG 78) disconnect the collection, holding a
vessels of the united states sixth fleetaboard uss porter (ddg-78)
US Navy 051103-N-0653J-007 A Sailor assigned to the Los Angeles-class fast attack submarine USS Memphis (SSN 691), holds his daughter
people at naval submarine base new londonuss memphis (ssn-691)
US Navy 051124-F-9927R-003 U.S. Navy Rear Adm. Mike Lefever, right, and Air Force translator Maj. Qureshi talk with a Pakistani grandmother holding her newborn granddaughter
united states navy in pakistanmichael a. lefever
US Navy 110518-N-YM863-133 Spc. Heather Correll holds remains to be committed to the sea during a burial at sea ceremony aboard the amphibious tran
burial at sea ceremonies of the united states navyaboard uss cleveland (lpd-7)
I am the originator of this photo. I hold the copyright. I release it to the public domain. This photo depicts a flower.
campanulaceaeplants
Children in Ribat-i-Abbasi of Nishapur (Hossein - Ali - Fatemeh - Hengameh and another girl - probably Afghani) 30
street scenecity
Children in Ribat-i-Abbasi of Nishapur (Hossein - Ali - Fatemeh - Hengameh and another girl - probably Afghani) 33
afghan diaspora in iranself-published work
Children in Ribat-i-Abbasi of Nishapur (Hossein - Ali - Fatemeh - Hengameh and another girl - probably Afghani) 35
afghan diaspora in iranself-published work
Boy Holding a Rooster, by Jacob Maentel, York, Lebanon, or Lancaster County Pennsylvania, 1815-1825, watercolor and ink on paper - Winterthur Museum - DSC01335
self-published workcc-zero
Juvenile Whooping Cranes in their holding pen at Wheeler National Wildlife Refuge, Decatur, Alabama.
animalsbird
Eagle hunter Leo Dorn holding an eagle.
animalsbird
Portrait of Joachim Murat, François Gérard
portraits of joachim murat by françois gérardsala 54 (palace of capodimonte)
Philippe Lenoir, Horace Vernet, 1814
portrait paintings by horace vernetromanticism
Two Male Figures, one holding a basket MET DP808820
18th-century unidentified artists in franceartworks without wikidata item
Plate 16- mythological figure holding a mirror Met DP885419
artworks with known accession numberartworks without wikidata item
Seated Man Holding a Jug MET DP802965
17th-century artwork by unknown roman-bolognese artistsartworks without wikidata item
Saint Cajetan of Thiene Holding the Infant Jesus MET DP812227
artworks without wikidata itemrogers fund
Christ Holding a Cross in a Niche Met DP889680
artworks without wikidata itemchristian art
Standing Youth Seen from Behind Holding a Bowl (Ganymede?) MET DP810206
artworks without wikidata itemrogers fund
Attributed to Jacques Louis David - Standing draped female figure, holding a triple cross in her hand and with a putto at her feet bearing a triple tiara, at her left foot an urn spouting water, D.225-1890
drawings by jacques-louis david in the victoria and albert museum
Dimitrie Cantemir - Foto01
18th-century engraved portraits of men at half length18th-century portraits wearing armour
Carlo Crivelli 039
paintings of madonna and child by carlo crivellirenaissance paintings of madonna and child
Peter Paul Rubens - Banquet d'Achéloüs
human hands holding drinking glassespaintings of cornucopia
Portrait of a member of the Thun family
18th-century portrait paintings of menartist
Rudolf Koller - Selbstbildnis mit 16 Jahren, an der Staffelei (1844)
19th-century oil portraits of sitting men at half length1844 portrait paintings of men
8801 - 8900 of 34,524 Next page
/ 346