39,001 Free Images of Common

drawings in musée carnavaletitalywikipediawikipanoramiogpsle vieux paris (françois alexandre pernot)françois alexandre pernottravelmaps
Venetian Carnival Mask - Maschera di Carnevale - Venice Italy - Creative Commons by gnuckx
mardi grascarnival
Sar Commun au Mouillage de Paranganu
landscapefish
Venezia Venice Italy - Creative Commons by gnuckx
travelmasks
Venetian Carnival Mask - Maschera di Carnevale - Venice Italy - Creative Commons by gnuckx
mardi grascarnival
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Ristorante Capricci di Sicilia - Palermo Italy Italia - Creative Commons by gnuckx
travelsummer
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Genova-Liguria-Italy - Creative Commons by gnuckx
architecturemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Fontana della Vergogna-Palermo-Sicilia-Italy - Creative Commons by gnuckx
italymaps
Venezia Italia - Venice Italy - Creative Commons by gnuckx
mardi grastravel
Venezia Venice Italy - Creative Commons by gnuckx
travelmasks
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Taormina-Sicilia-Italy - Creative Commons by gnuckx
mapsufo
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Jumping Spider
spiderplants
Albert E. Smith (film producer) Faversham Home
architecturehouse
Common Avens (Geum urbanum), Asarabacca (Asarum europaeum), Birch (Betula pubescens), and Biting Persicaria (Persicaria hydropiper).
medicinehealth
Le couvent des Bernardins. D.6554, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
La princesse de la rampe - Rôle de Suzanne. ( 1er costume). D.8098(41) (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Vue du Louvre et de la porte de Nesle. D.6621, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le Royaume du Calembourg - Rôle de la Renommée (4eme costume). D.8098(26), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Rue de Jérusalem en octobre 1857. D.6644, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Eglise Saint-Jacques-du-Haut-Pas et séminaire Saint-Magloire. D.6563, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Vue de Montfaucon. D.6635, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
L'Hôtel-Dieu du côté du Petit-Pont. D.6521, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le gibet de Montfaucon. D.6636, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
L'ancien évêché en 1600. D.6553, François Alexandre Pernot
palais de l'archevêché de parisdrawings in musée carnavalet
Ohé les p'tits agneaux. - Rôle d'Olibrius. (3e costume). D.8098(46) (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Ohé les p'tits agneaux. - Rôle d'Olibrius. ( 1er costume). D.8098(44) (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Angle de la rue de Richelieu et de la rue Molière (), D.6615, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le palais de la Cité d'après un ancien plan. D.6665, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Vue du pont Notre-Dame et du quai de Gesvre. D.6627, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Les lempions de la Veille et les lanternes du lendemain. - Rôle de la Politique. 1er costume. D.11333 (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Fragment de statue provenant de Notre-Dame. D.6459, François Alexandre Pernot, 1853
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Vue du Louvre sous François Ier prise à l'intérieur des remparts. D.6625, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Fragment de statue de Notre-Dame. D.6453, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Restes de l'église Saint-Paul. D.6466, François Alexandre Pernot, En 1839
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Restes de l'église Saint-Etienne-des Grès en 1863. D.6515, François Alexandre Pernot, En 1863
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Fragment de statue du portail de Notre-Dame. D.6451, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Les thermes de Julien en 1834. D.6631, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le Vieux Paris St Jean en Grève N°46. G.52924 (1 of 2)
le vieux paris (edouard auguste nousveaux)engravings in musée carnavalet
Vue du Pont-Neuf en 1835. D.6643, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le Royaume du Calembourg - Rôle de la Frégate Ecole (1er costume). D.8098(23), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
L'église Saint-Honoré, rue des Bons-Enfants. D.6445, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Château du Louvre sous Charles V. D.6607, François Alexandre Pernot
drawings in musée carnavaletmedieval louvre
Vue extérieure de l'Hôtel-Dieu recto, D.6551 (2 of 2), François Alexandre Pernot
historical images of pont royaldrawings in musée carnavalet
Vue d'une partie du couvent des Célestins et de l'Arsenal. D.6623, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Map of British Military Operations in New York and New Jersey in 1776 (73 MB), George Hayward, 1864
maps of the new york and new jersey campaignmaps showing 1776
The Return of the Holy Family to Nazareth, Nicolas Poussin, 1622
the return of the holy family to nazareth (1953.156) by nicolas poussinclassicism
THE DUCHAMP PARADOX
creative commonsfountain
Common wooly sunflower. Eriophyllum lanatum. Perennial flower to 2 feet tall. Showy planted with Penstemons and Blue-eyed grass. The Botanical Register vol. 14 (1828)
illustrationplants
n158_w1150
historybird
Barricade de la place de la Bastille. D.6666, François Alexandre Pernot, En 1848
drawings in musée carnavaletjune days uprising
Maison où mourut le duc d'Orléans le 13 juillet 1842, rue de la Révolte. D.6662, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
'Everybody works but--.' A common scene in the tenements. Father sits around. 'Sometime I make $9.00, sometime $10.00 a week on the railroad; sometime nottin'.' Helen, 5 years old, and LOC nclc.04089
historicalhistory
Nemrut Mount
mountainturkey
P-270-JIRA0051-Chim.jpg
businesscomputer
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
Hyacinth
springplants
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
Italy Catania - Creative Commons by gnuckx
landscapemaps
Taormina-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Taormina-Sicilia-Italy - Creative Commons by gnuckx
mapscity
Ristorante Capricci di Sicilia - Palermo Italy Italia - Creative Commons by gnuckx
travelsummer
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Ducks at Porto Ulisse Ognina Catania Sicilia taly - Creative Commons by gnuckx
animalstravel
Statue in a Shop - Venice Italy Venezia - Creative Commons by gnuckx
travelmasks
Medjugorje - Hotel Pansion Porta - Bosnia Herzegovina - Creative Commons by gnuckx
travelmaps
Place du Châtelet et la Colonne du Châtelet Paris France - creative commons by gnuckx
travelparis
Etna Volcano Paroxysmal Eruption July 30 2011 - Creative Commons by gnuckx
landscapemountain
Taormina-Sicilia-Italy - Creative Commons by gnuckx
travelmaps
Bougainvillea-Taormina-Sicilia-Italy - Creative Commons by gnuckx
flowermaps
Nyckelviken oaks
naturefilm
Hyaeus dilatatus,m, back, J. Smit, Netherlands_2022-02-08-16.20
explore creative commons week 26 2022netherlands
Where am I?
explore creative commons week 43 2021portmeirion
Sunset highway background. Original public domain image from Flickr
backgroundtravel
Vue de Notre-Dame (façade Sud) et de l'Archevêché en 1830. D.6552, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ancien portail de l'église Saint-Gervais. D.6566, François Alexandre Pernot
historical images of église saint-gervais-saint-protaisdrawings in musée carnavalet
Fort de la Tournelle et porte Saint-Bernard. D.6618, François Alexandre Pernot
château de la tournelle (paris)drawings in musée carnavalet
Alexandr Yakovlev. Kuli-kuta dance (1924-1925), between 1924 and 1925
african journey by alexander yakovlevneoclassicism
Le petit pont et la porte du Châtelet. D.6628, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Rue du Foin, escalier de la reine Blanche pour monter sur sa haquenée. D.6660, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Shelby County, Iowa. A common type of barn. Like most service buildings in the community, it is in e . . . - NARA - 522431
historicalhistory
Hyman Lapcoff, 1526 Fourteenth St., N.W., Washington, D.C., a ten year old newsie from a good family, carrying a heavy load of newspapers quite a distance. This is a common occurrence and is LOC cph.3c24950
historicalhistory
n140_w1150
animalstravel
Drawing, Bamboos, Vine and a Young Palm, Plant, and Two Scenes of Rain Falling from Clouds over Ridges, Rio Magdalena, Colombia, 1853, probably May, Frederic Edwin Church, 1853, probably May
sketches of south america by frederic edwin churchhudson river school
n362_w1150
north americabird
Kantoorgebouw Hermes - Hermes Office Building (4750950153)
gedempte glashaven (rotterdam)zuiderkerk (rotterdam)
6
photographywater
The Orion Nebula complex
astronomyspace
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
2011.05 - 'Urban still life', from some bicycles to the wall, including a graffiti tag / sign, in the Nieuwe Kerkstraat; geotag free urban picture, in public domain / Commons CCO; city photography by Fons Heijnsbroek, The Netherlands
bicyclestreets
Bougainvillea-Taormina-Sicilia-Italy - Creative Commons by gnuckx
summermaps
Italy-Roma - Creative Commons by gnuckx
travelmaps
Italy-Vatican - Creative Commons by gnuckx
travelmaps
32401 - 32500 of 39,001 Next page
/ 391