39,001 Free Images of Common

italypanoramiodrawings in musée carnavaletgpswikiwikipediatravelsicilyle vieux paris (françois alexandre pernot)françois alexandre pernot
Ristorante Capricci di Sicilia - Palermo Italy Italia - Creative Commons by gnuckx
travelsummer
License Free Photo - Creative Commons by gnuckx
travelsea
Etna Volcano Paroxysmal Eruption October 26 2013 - Creative Commons by gnuckx
landscapemountain
Italy-Roma - Creative Commons by gnuckx
travelmaps
Venetian Carnival Mask - Maschera di Carnevale - Venice Italy - Creative Commons by gnuckx
mardi grascarnival
Fontana della Vergogna Palermo Italy - Creative Commons by gnuckx
travelcity
All men are created equal - Creative Commons by gnuckx
mapsufo
Ducks at Porto Ulisse Ognina Catania Sicilia taly - Creative Commons by gnuckx
travelsea
Giardini Naxos-Messina-Sicilia-Italy - Creative Commons by gnuckx
vehiclemaps
Brucoli Sicilia Italy - Creative Commons by gnuckx
travelsea
Taormina-Sicilia-Italy - Creative Commons by gnuckx
mapsufo
License Free Photo - Creative Commons by gnuckx
vehiclefish
Roadside Milkweed at DeSoto National Wildlife Refuge in Iowa
springsummer
Dandelion
dandelionflower
Roadside Milkweed at DeSoto National Wildlife Refuge in Iowa
springsummer
Roadside Milkweed at DeSoto National Wildlife Refuge in Iowa
springsummer
Enceinte de Philippe Auguste derrière les Jacobins d'après le plan de Verniquet, D.17405, Alfred Bonnardot
couvent des jacobins de la rue saint-jacquesfloor plans in musée carnavalet
Schwäbisch Hall - Hällisch-Fränkisches Museum - Schützenscheibe mit Stadtansicht und Fortuna - auf weiß
painted targets in hällisch-fränkisches museum (schwäbisch hall)history of schwäbisch hall
Tombes et monument des Combattants de Juillet 1830, Champ-de-Mars. D.6652, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Tombeau des combattants de Juillet 1830 sur le Champ-de-Mars. D.6651, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
17 Garçon votre parole d'honneur est-ce bien de la tête de Veau. Paris Musées 20230511212633, Faustin Betbeder
prints in musée carnavaletparis bloqué (faustin)
Cérémonie de remise de l'Ordre du Saint Esprit le 3 juin 1724, par Nicolas Lancret, détail. Paris Musées 20230827152254
la remise de l'ordre du saint-esprit (nicolas lancret) in musée carnavaletnicolas lancret
On irritation and insanity - a work, wherein the relations of the physical with the moral conditions of man are established on the basis of physiological medicine (1831) (14586397907)
1831 portrait lithographs of men1831 books
Fort de la Tounelle, porte Saint-Bernard, les Célestins, Grand Arsenal, Saint-Marcel et Saint-Hippolite. D.6585, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Round Landmark Icon Railway Station
landmark icons by user:bmaczerotrain stations in art
Gul Muhammad Khan of the Ghilzais, Edmund Walker, 1848
19th-century men of afghanistangul muhammad khan
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 14
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 08
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
Exposition du système naturel des nerfs du corps humain - suivie des mémoires sur le même sujet, lus devant la Société Royale de Londres (1825) (14583578798)
exposition du système naturel des nerfs du corps humain (1825)anatomical plates and drawings of human nerves
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 11
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
Presentation Wide
presentation widedraft
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 13
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
Exposition du système naturel des nerfs du corps humain - suivie des mémoires sur le même sujet, lus devant la Société Royale de Londres (1825) (14769886712)
exposition du système naturel des nerfs du corps humain (1825)neuroanatomy of humans
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 09
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 10
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
Exposition du système naturel des nerfs du corps humain - suivie des mémoires sur le même sujet, lus devant la Société Royale de Londres (1825) (14767044181)
exposition du système naturel des nerfs du corps humain (1825)neuroanatomy of humans
Exposition du système naturel des nerfs du corps humain - suivie des mémoires sur le même sujet, lus devant la Société Royale de Londres (1825) (14583575838)
exposition du système naturel des nerfs du corps humain (1825)anatomy of the human eye
Pink Birthday Party Cake Sprinkles Background
celebritiesfood
Statue Rome Italy Roma - Creative Commons by gnuckx
travelmaps
Common Darter, Sympetrum striolatum
animalsinsects
Venezia Italia - Venice Italy - Creative Commons by gnuckx
travelmasks
2014.03 - Amsterdam photo, sculpted turkeys in early Spring on a stone bench, in the garden of the Rijksmuseum; a geotagged free urban picture, in public domain / Commons CCO; city photography by Fons Heijnsbroek, The Netherlands
furniturestones
Solar salt. (15)
new zealandwater
Chernobyl disaster (Creative Commons)
disastercity
Natural Reserve Vendicari Noto Sicilia Italy - Creative Commons by gnuckx
travelwater
Taormina-Sicilia-Italy - Creative Commons by gnuckx
travelmaps
Macro Monday 06
berriestree
License Free Photo - Creative Commons by gnuckx
travelsea
Maine Coon - Chimsky - Creative Commons by gnuckx
animalsmaps
Italy-Palermo - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
License Free Photo - Creative Commons by gnuckx
travelsea
Taormina-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
License Free Photo - Creative Commons by gnuckx
travelwater
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Fontaine du Palmier vers Palais de Justice Paris France - creative commons by gnuckx
travelparis
Taormina-Sicilia-Italy - Creative Commons by gnuckx
mapsufo
Hotel Ca' Sagredo - Grand Canal - Rialto - Venice Italy Venezia - Creative Commons by gnuckx
travelitaly
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Genova Liguria Italy - Creative Commons by gnuckx
mapscity
Ristorante Capricci di Sicilia - Palermo Italy Italia - Creative Commons by gnuckx
travelsummer
Venezia Venice Italy - Creative Commons by gnuckx
landscapetravel
Taormina-Sicilia-Italy - Creative Commons by gnuckx
travelmaps
Noto-Syracuse-Sicilia-Italy - Creative Commons by gnuckx
landscapemaps
Yatching Porto Ulisse Ognina Catania Sicilia taly - Creative Commons by gnuckx
travelwater
07671jfHeritage Park Library Bustos, Bulacan Municipal Hallfvf 12
photographs of carta hydrographica y chorographica de las yslas filipinasbaroque painting
Shelby County, Iowa. Abandonment is not common in this region. Apparently the house shown here was n . . . - NARA - 522334
historicalhistory
Fragment de statue provenant du portail de Notre-Dame. D.6457, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ruines de l'ancien hôtel de Noailles, rue Saint-Honoré. D.6576, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ancienne église de Saint-Sulpice. D.6565, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
La Samaritaine et le Vieux Louvre vers 1635. D.6603, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Vue extérieure de l'église des Carmes, place Maubert, avant 1790. D.6550, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ancien cimetière de l'abbaye de Saint-Germain en 1820-1822. D.6555, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
La croix du Trahoir. D.6589, François Alexandre Pernot
fontaine de la croix du trahoirdrawings in musée carnavalet
Restes de l'église des Mathurins de la rue Saint-Jacques en 1863. D.6517, François Alexandre Pernot, En 1863
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
La tour des Petits-Pères en 1845. D.6519, François Alexandre Pernot, En 1845
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Emplacement de l'hôtel de l'amiral de Coligny. D.6610, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
L'hôtel de Noailles, rue Saint-Honoré, pendant la démolition en 1830. D.6630, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ancienne façade de Saint-Germain-l'Auxerrois. D.6542, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Saint-Denis-de-la-Chantre dans la Cité, d'après Israël Silvestre. D.6539, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Chapelle Saint-Julien-des-Ménétriers. D.6442, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Gibet de Montfaucon. D.6637, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Les Princesses de la rampe. - Rôle de Suzanne (2e costume). D.8098(42) (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Fragments de statues provenant du portail de Notre-Dame. D.6458, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Eglise Saint-Yves, rue Saint-Jacques. D.6584, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Vue extérieure de Saint-Germain-l'Auxerrois en 1831. D.6591, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
La tour de Nesle d'après Callot. D.6632, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Rue Saint-Jacques près Sainte-Geneviève en 1863. D.6523, François Alexandre Pernot, En 1863
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Ohé les p'tits agneaux. - Rôle d'Olibrius. (2e costume). D.8098(45) (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Démolition du pont Saint-Michel en 1857. D.6649, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Le jardin des Plantes. D.6613, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Les Enfers de Paris - Rôle du Mis. de Rioja (4eme costume). D.8098(4), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Les lempions de la Veille et les lanternes du lendemain. - Rôle dde Vivendière. 3e costume. (Cérito), D.11335 (2 of 2), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Quatorze de Dames - Rôle de Ludovic de Méranges (2eme costume). D.8098(12), Jacques Léon Dusautoy
drawings in musée carnavaletscriwaneck
Le couvent des Bernardins. D.6586, François Alexandre Pernot
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
Entrée de la rue de la Roquette. D.6502, François Alexandre Pernot, Entre 1848 — 1849
le vieux paris (françois alexandre pernot)drawings in musée carnavalet
32101 - 32200 of 39,001 Next page
/ 391