110,450 Free Images of C

cc-zerofiles uploaded by daderotcc-pd-markaboard uss john c. stennis (cvn-74)author died more than 100 years ago public domain imagesvehiclenavyaircraftshipauthor died more than 70 years ago public domain images
US Navy 120206-N-ZC343-598 Tugboats assist the Arleigh Burke-class guided-missile destroyer USS Spruance (DDG 111) away from the pier as the ship d
boatship
US Navy 120203-N-OY799-182 U.S. Navy ships are alongside each other during a fueling at sea
boatship
US Navy 040722-N-3019M-003 Sailors aboard the Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) render honors to the USS Arizona Memorial as it arrives in Pearl Harbor after participating in RIMPAC 2004
vehiclenavy
US Navy 040929-N-0295M-004 Program Manager, Tomahawk All-Up-Round Programs, and Master of Ceremonies, Capt. Robert E. Novak, speaks to the audience as the U.S. Navy formally welcomes Raytheon Company's Tomahawk Block IV c
people of the united states navyaboard uss stethem (ddg-63)
US Navy 060207-N-7232R-120 An F-A-18F Super Hornet from the
militaryvehicle
US Navy 060509-N-2568S-215 SECNAV watches as Sailors assigned to EOD-1 demonstrate the work they do with Marine Mammals
californiawater
US Navy 060602-N-3642E-003 Director, Undersea Technology Naval Sea Systems Command (SEA 073) Commander, and Naval Undersea Warfare Center Rear Adm. Stephen E. Johnson, briefs Secretary of the Navy
donald c. winter in 2006army
US Navy 040204-N-5821W-004 Members of Explosive Ordnance Mobile Unit Eight (EODMU-8) wait to board an Air Force C-130 Hercules
aircraftvehicle
U.S. INDO-PACIFIC COMMAND CHANGE OF COMMAND CEREMONY 210430-N-XC372-1486
change of command ceremonies at joint base pearl harbor-hickamjohn c. aquilino
US Navy 110126-N-7981E-009 The Nimitz-class aircraft carrier USS Carl Vinson (CVN 70) leads the Royal Malaysian Navy frigate KD Lekir (FF 26) and c
boatsea
US Navy 110830-N-ZZ999-780 An MH-60S Sea Hawk helicopter assigned to the Eightballers of Helicopter Sea Combat Squadron (HSC) 8 transfers cargo dur
vehicleship
US Navy 110830-N-ZZ999-520 Senior Chief Naval Air Crewman Todd Yates, from Granger, Ind., looks out the cabin of an MH-60S Sea Hawk helicopter
helicopter sea combat squadron 8 (united states navy)general views of uss john c. stennis (cvn-74)
US Navy 101108-N-3885H-199 Dana Jacobson, left, one of the hosts of the ESPN2 television show, ESPN First Take, speaks with Rear Adm. Nora Tyson, c
militaryarmy
US Navy 101116-N-4047W-005 The Los Angeles-class attack submarine USS San Francisco (SSN 711) departs for its six-month western Pacific Ocean
waterboat
US Navy 100612-N-7908T-258 Aviation Boatswain's Mate (Handling) Airman Destiny C. Phillips moves models along the ship's Ouija board aboard USS George H.W. Bush (CVN 77)
ouija boards (aircraft carrier)indoor
US Navy 070124-N-3038W-088 Electrician's Mate 2nd Class Robert Ramirez ponders his next move on the giant chess board during the Morale Welfare and Recreation events held in the hangar bay of the Nimitz-class aircraft car
aboard uss john c. stennis (cvn-74)giant street chess
US Navy 070209-N-3038W-163 A flight deck director instructs the pilot of an F-A-18C Hornet from the Blue Diamonds
militaryvehicle
US Navy 070206-N-3729H-336 Guided missile destroyer USS O'Kane (DDG 77) transits in formation during a photo exercise showcasing the entire John C. Stennis Carrier Strike Group (JCSSG) off the coast of Guam
boatsea
US Navy 070210-N-3038W-043 Aviation Ordnanceman 3rd Class Travis Alverson helps guide the gun turret onto rails so it can be raised into an F-A-18F Super Hornet
aboard uss john c. stennis (cvn-74)aviation ordnanceman
US Navy 070217-N-3729H-049 From left to right, Aviation Boatswain's Mate Airman Eric Labrecque, Airman Thomas Gerold, and Aviation Boatswain's Mate 3rd Class Dusty Garcia stand watch in hangar deck control
aboard uss john c. stennis (cvn-74)ouija boards (aircraft carrier)
US Navy 081011-N-9610C-007 ospital Corpsman Dami-anne Boykin gives Aviation Electronics Technician 3rd Class Michael Morgan his yearly tooth cleaning
aviation electronics technicianface shield
US Navy 070824-N-2659P-191 Nimitz-class aircraft carrier USS John C. Stennis (CVN 74) leads guided-missile cruiser USS Antietam (CG 54) prior to conducting an air power demonstration
vehiclesea
US Navy 090109-N-1120L-075 Seabees and Air Force airmen maneuver 463L pallets into an Air Force C-17 aircraft
united states navy in the iraq waral anbar governorate
US Navy 090120-N-6538W-009 Aviation Boatswain's Mate 1st Class Gene Dunn, from Marysville, Wash., center, briefs Sailors about upcoming aircraft movements in hangar deck control
ouija boards (aircraft carrier)aviation boatswain's mate
US Navy 070507-N-4649C-120 Cmdr. Thomas C. Halvorson, commanding officer of Arleigh Burke-class guided missile destroyer USS John S. McCain (DDG 56) reviews the Russian fleet as the ship arrived in Vladivostok, Russia
united states navy images from vladivostoknavy people of russia
US Navy 090415-N-6597H-077 Aviation Ordnanceman 3rd Class David Kopp, from Killeen, Texas, cleans a simulated Otto II fuel spill as part of the primary response team during a general quarters drill in the hangar bay aboard the
aboard uss john c. stennis (cvn-74)aviation ordnanceman
US Navy 090414-N-6597H-023 Machinist Mate 3rd Class Thomas Armstrong, from Denver, Colo., transfers liquid oxygen into a liquid oxygen servicing cart before transferring it to the flight deck of the Nimitz-class aircraft carrie
aircraft liquid oxygen replenishmentaboard uss john c. stennis (cvn-74)
US Navy 090215-N-8157C-519 An F-A-18F Super Hornet from the
aircraftvehicle
US Navy 070715-N-8119R-098 Capt. Michael C. Manazir, commanding officer USS Nimitz (CVN 68), points out three Super Hornets, assigned to Carrier Air Wing (CVW) 11, to Lt. Regina Rogers aboard nuclear-powered aircraft carrier US
aboard uss nimitz (cvn-68)
US Navy 030305-C-9409S-007 Seaman Charmeka Breckenridge and Seaman Nicole Hays, assigned to the amphibious transport dock USS Comstock (LSD 45), take a break from work while underway in the North Arabian Gulf
united states navy images from the persian gulfaboard uss comstock (lsd-45)
US Navy 050504-C-3721C-345 Crew members stationed aboard the U.S. Coast Guard Cutter Valiant (WMEC 621), pass a fuel line to an HH-65 Dolphin helicopter crew during a training exercise in the Gulf of Mexico
eurocopter hh-65/mh-65 dolphinuscgc valiant (wmec-621)
US Navy 070918-N-0989H-016 Capt. Douglas Wied, commander of Task Group 40.9, greets the Honorable Brenda LaGrange Johnson, U.S. Ambassador to Jamaica, and her guest upon their arrival to the Boundbrook Wharf
united states navy in jamaicadouglas c. wied
A Snowy Owl Bubo scandiacus was spotted at Smithville Lake on the rip rap of the dam on 2 Jan 2012. Three Snowy Owls have been seen at the lake since early December 2011. Photo courtesy of Christine C
animalsbird
A portion of the Green River on Seedskadee NWR remains open during the winter. Releases from Fontenelle Dam above the Refuge help to maintain open water even in the coldest winters. The open water, c
animalsbird
PRESERVED_SPECIMEN; ; ; microslide; Det. by: William C. Banta; IZ number 89357; lot count 1; Microslide 01, fragment; Microslide 02, fragment; Microslide 03, fragment; 1988-09-20T00:00:00Z
sea lifebryozoa
US Navy 100118-N-3327M-003 Aviation Electronics Technician Airman Ryan Coffey, assigned to the Wallbangers of Carrier Airborne Early Warning (VAW) 117, performs final checks on an E2-C Hawkeye
carrier airborne early warning squadron 117 (united states navy)aboard uss nimitz (cvn-68)
US Navy 091209-N-2475A-020 Logistics Specialist 2nd Class Dan Foster, from Hutchinson, Kan., performs respirator fit tests on Sailors in hangar bay one
peoplegroup
US Navy 100207-N-4954I-005 Mass Communication Specialist 1st Class Steven Owsley, middle, from Houston, shows Green Bay Packers John Kuhn, left, and Mason Crosby, right, an enlisted rack in a male berthing space
aboard uss john c. stennis (cvn-74)mass communication specialist
US Navy 091012-N-9132C-128 A Sailor communicates with the pilots of an SH-60B Sea Hawk helicopter assigned to the Battle Cats of Light Helicopter Anti-Submarine Squadron (HSL) 43 aboard the aircraft carrier USS Ronald Reagan (C
militaryvehicle
US Navy 110430-N-RM525-289 Commodore Brian Nickerson, mission commander for Continuing Promise 2011, talks with local media during a press conferen
continuing promise 2011group
US Navy 111219-N-OY799-077 An EA-6B Prowler from the Wizards of Electronic Attack Squadron (VAQ) 133 lands on the flight deck of the Nimitz-class
vehiclesea
US Navy 111220-N-OY799-224 Culinary Specialist Seaman Jon Ketola grills lobster tails in preparation for the Christmas meal in the aft galley aboar
chef's hatfood
US Navy 111222-N-OY799-246 Sailors stand watch on the flight deck as an F-A-18F Super Hornet from the Black Aces of Strike Fighter Squadron (VFA) 4
vehiclenavy
US Navy 110624-F-ET173-114 Commodore Brian Nickerson, mission commander of Continuing Promise 2011, answers questions from journalists following a
celebritiespeople
US Navy 111011-N-VN693-104 Aviation Structural Mechanic Airman Philip Alexander, from Roseville, Calif., checks the edge of a rotor blade on an MH
aboard uss john c. stennis (cvn-74)helicopter tail rotors
US Navy 111014-N-YZ751-066 Gunner's Mate Seaman Apprentice Lauren C. Hanley fires a MK-38 25 mm machine gun aboard the guided-missile destroyer USS
mk 38 25mm chain gunnavy
US Navy 111121-N-BT887-162 An F-A-18C Hornet from the Golden Dragons of the Strike Fighter Squadron (VFA) 192 launches from the Nimitz-class aircra
militaryaircraft
US Navy 111123-N-OY799-206 Sailors from crash and salvage stand watch on the bow as an F-A-18F Super Hornet from the Black Aces of Strike Fighter S
aircraftvehicle
US Navy 111125-N-BT887-028 n F-A-18E Super Hornet assigned to the Tophatters of Strike Fighter Squadron (VFA) 14 launches from the Nimitz-class air
vehiclesea
US Navy 090508-N-9928E-032 PACIFIC OCEAN (May 8, 2009) Aerographer's Mate 2nd Class Derron Gee, from East Haven, N.Y., uses a handheld anemometer to determine wind speed
aerographer's matecup anemometer
US Navy 090918-N-6538W-010 viation Structural Mechanic 2nd Class Evan Young, from Sonora, Calif., stabilizes a rotor blade on an MH-60S Sea Hawk
aboard uss john c. stennis (cvn-74)vehicle
US Navy 090325-N-9928E-128 Aviation Boatswain's Mate (Fuels) Airman Travis Hinde from Des Plaines, Ill., refuels an F-A-18C Hornet from the
aviation boatswain's matefuel
US Navy 110927-N-ZZ999-021 An F-A-18C Hornet assigned to the Golden Dragons of Strike Fighter Squadron (VFA) 192 launches from the Nimitz-class air
aircraftflight
US Navy 111003-N-BT887-277 Troubleshooters assigned to the Golden Hawks of Airborne Early Warning Squadron (VAW) 112 give the approval to launch
militaryvehicle
US Navy 111024-N-OY799-103 Sailors clean the canopy on an F-A-18F Super Hornet assigned to the Black Aces of Strike Fighter Squadron (VFA) 41 aboar
militaryaircraft
US Navy 111207-N-XE109-076 Aviation Boatswain's Mate (Handling) 3rd Class Clarissa K. Quick signals to a C-2 Greyhound as it launches from the flig
aircraft launches from uss george h. w. bush (cvn-77)skateboarding
Flickr - Official U.S. Navy Imagery - The Arleigh Burke-class guided-missile destroyers USS Kidd (DDG 100), USS Dewey (DDG 105) and USS Pinckney (DDG 91) are underway with the Nimitz-class aircraft carrier USS John C. Stennis.
colorblue
Patrol vessels guide the aircraft carrier USS Ronald Reagan (CVN 76) into Naval Air Station North Island
watersea
200323-N-DC385-2231 (49704357276)
boatship
Trepanned skull, found at Börnecke Schützenholz, c. 3300 BC, human skull - Braunschweigisches Landesmuseum - DSC04591
self-published workcc-pd-mark
Warrior Figure, probably Mixcoatl-Camaxtle deity, unidentified Huastec artist, Xico Viejo, Veracruz, Mexico, c. 1440-1521 AD, sandstone - Brooklyn Museum - Brooklyn, NY - DSC08459
self-published workcc-zero
Box-shaped stone coffin, Oshinozuka No. 2 tumulus, Sakura City, Chiba prefecture, late to final Kofun period, c. 500s-600s AD - Kokugakuin University - Shibuya, Tokyo, Japan - DSC05531
architecturegreen
'Saint Cornelius and Angel', stained glass lancet windows by Tiffany Studios, c. 1910
1910 stained-glass windows in the united statesself-published work
Turk, Bow Porcelain Factory, c. 1770, soft-paste porcelain - Wadsworth Atheneum - Hartford, CT - DSC05223
self-published workcc-pd-mark
The Four Evangelists (Matthew, Mark, Luke, and John), Venice, c. 1580-1590, bronze - Bode-Museum - DSC02505
self-published workcc-pd-mark
The Princeton Hoard of Parthian drachmas, c. 128-38 BC - Princeton University Art Museum - DSC06879
self-published workcc-pd-mark
The Resting Diana after Jean Goujon (c. 1530-1568), erected in 1964 - Stockholm, Sweden - DSC00759
self-published workcc-pd-mark
Two tobacco jars, Chantilly Porcelain Factory, c. 1743, soft-paste porcelain - Wadsworth Atheneum - Hartford, CT - DSC05411
self-published workcc-pd-mark
The Adoration of the Magi, Cosme Tura, Italy, c. 1480, tempera on panel - Fogg Art Museum, Harvard University - DSC01094
self-published workcc-pd-mark
The Zams Altarpiece, Virgin and Child with Saints, Tirol, perhaps Landeck, c. 1485, Swiss stone pine - Bode-Museum - DSC03564
self-published workgold
The Peaceable Kingdom by Edward Hicks, c. 1846-1847, oil on canvas - Dallas Museum of Art - DSC04800
self-published workcc-pd-mark
The Religion of Business, by Charles Allan Winter, c. 1915, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01339
self-published workcc-pd-mark
The Resting Diana after Jean Goujon (c. 1530-1568), erected in 1964 - Stockholm, Sweden - DSC00763
self-published workcc-pd-mark
Puma by August Gaul, Berliner Kunst-Keramik, Berlin-Neukolln, c. 1922 - Keramik-Museum Berlin - DSC04175
self-published workcc-pd-mark
Teapot in the form of a nautilus shell, Meissen, c. 1710-1720, red Bottger stoneware - Germanisches Nationalmuseum - Nuremberg, Germany - DSC02615
self-published workcc-pd-mark
Telegraph set, presented to Weston Hadden by Mr. Walter C. Humstone - Bennington Museum - Bennington, VT - DSC08646
self-published workboxing
Holy Kinship, Silesia, view 1, c. 1500, beech wood - Bode-Museum - DSC03100
self-published workgold
Lucy Dodge Allen by Antoine Chatelaine, detail, c. 1834, oil on canvas - Peabody Essex Museum - DSC06963
self-published workcc-pd-mark
Landscape by Russell King Robertson (1820-1909), c. 1850-1880, oil on canvas - Bennington Museum - Bennington, VT - DSC09161
self-published workwater
Last Supper, Germany, c. 15th century - Museum, Haddon Hall - Bakewell, Derbyshire, England - DSC02960
self-published workcc-pd-mark
Lovers embracng on a canopied bed, Orissa, India, c. 1300, ivory - Freer Gallery of Art - DSC04518
self-published workcc-pd-mark
Mourning women by Tilman Riemenschneider workshop, Würzburg, c. 1508, linden wood - Landesmuseum Württemberg - Stuttgart, Germany - DSC02673
self-published workcc-pd-mark
Mourning Virgin from a Crucifixion, Steiermark, c. 1420-1425, Swiss pine - Bode-Museum - DSC03475
self-published workcc-pd-mark
Mrs. Aaron Davis (nee Theoda Williams, 1764-1834), by Gilbert Stuart, c. 1816, oil on panel - Chazen Museum of Art - DSC02148
american paintings in the chazen museum of artself-published work
Nationale oldtimerdag Zandvoort 2010, 1931 PEUGEOT 201 C, 18-59-ZE pic3
1931 peugeot automobilescc-zero
Mirror with lion-and-grape design, Tang dynasty, c. late 7th century AD, bronze - Arthur M. Sackler Gallery - DSC05942
self-published workcircle
Musée zoologique de Strasbourg en 2013 02
vehiclecity
Netherlands tile depicting shoemaker stitching footware, 2 of 2, c. 1630, ceramic - Bata Shoe Museum - DSC00293
azulejos de figura avulsaself-published work
News from the Fleet, by Augustus W. Buhler, c. 1918, oil on canvas - Cape Ann Museum - Gloucester, MA - DSC01406
self-published workcc-pd-mark
Niagara Falls pitcher, United States Pottery Company, c. 1855, porcelain - Portland Museum of Art - Portland, Maine - DSC04216
self-published workcc-pd-mark
Neptune and Dolphin, by Gian Lorenzo Bernini workshop, c. 1622, bronze - Galleria Borghese - Rome, Italy - DSC04720
self-published workcc-pd-mark
Méligny-le-Petit (Meuse) fontaine C
self-published workpages with maps
Man's eider duck feather parka, Qikirtamiut, Belcher Islands, Hudson Bay, c. 1914 - Royal Ontario Museum - DSC00312
birdskin (clothing)eider
Linen, Thebes, tomb of Hatnofer and Ramose, New Kingdom, Dynasty 18, reign of Hatshepsut, c. 1503-1473 BC, flax, pigment - Oriental Institute Museum, University of Chicago - DSC07902
ancient egyptian textiles in the oriental institute museumself-published work
Little Gooseman Fountain, probably by Hans Peisser, c. 1550, linden wood - Stadtmuseum Fembohaus - Nuremberg, Germany - DSC02197
self-published workcc-pd-mark
Mary Magdalen and Jesus in the Garden, from the Ermita de San Baudelio, by the Master of San Baudelio and the Master of Maderuelo, Spain, c. 1125-1150, fresco transferred to canvas - Cincinnati Art Museum - DSC04460
self-published workcc-zero
Mary and Child by Tilman Riemenschneider, c. 1500, linden wood - Mainfränkisches Museum - Würzburg, Germany - DSC04828
self-published workcc-pd-mark
Madonna and Child by Guidoccio di Giovanni Cozzarelli, Italy (Siena), c. 1480-1485, tempera and gold on wood panel - Chazen Museum of Art - DSC02027
self-published workcc-zero
Madonna and Child by Carlo Crivelli, Venice, c. 1468, tempera and oil on panel - San Diego Museum of Art - DSC06726
self-published workcc-zero
Madonna with the Blessing Child, Italian School - Tuscany, c. 1480-1485, tempera, oil & gilding on wood
self-published work2011 photographs
24201 - 24300 of 110,450 Next page
/ 1105