19,364 Free Images of 1st

cc-zerofiles uploaded by daderotcc-pd-markauthor died more than 100 years ago public domain imagesvehiclewateraircraftmilitarynavyoil on canvas
The Flag, Albuhera, 16 May 1811, George Dawe, 1819
rowland hill, 1st viscount hillportraits by george dawe
Portrait of Sebastião José de Carvalho e Melo, 1st Marquess of Pombal, Louis-Michel van Loo, 1766
portrait of sebastião josé de carvalho e melo, 1st marquis of pombal by louis-michel van loo and claude joseph vernetclassicism
The Flag, Albuhera, 16 May 1811, William Barnes Wollen, c. 1912
works by william barnes wollenbattle of albuera
Pedro I of Brazil and Charles Stuart
neoclassicismléon tirode
LordChancellorWilliamCowper, Thomas Murray
william cowper, 1st earl cowperthomas murray
Portrait of Nicholas Vansittart, 1st Baron Bexley (1766-1851), Thomas Lawrence
male portrait paintings by thomas lawrenceromanticism
Prince Rupert - 1st English Civil War
robert of palatinate-simmern, duke of cumberlandbaroque painting
Picton Castle in Wales, 1880
historic houses in walespicton castle in art
Regimental Colour of the 1st Infantry Division of the Hungarian Defence Forces (1946-1949)
self-published workwhite flag
James William Lowther, MP, Speaker of the House of Commons, Philip de László
male portraits by philip alexius de lászlócarlisle citadel
Sir Charles Gould Morgan, 1st Baronet Morgan, MP (1726 - 1806), Mather Brown, 1792
works attributed to mather browntredegar house, newport
Portrait of George James, 1st Marquess of Cholmondeley by Batoni, Pompeo Girolamo, Pompeo Batoni, 1772
male portraits by pompeo batoniclassicism
The Earl of Burlington (centre) with Evelyn Pierrepont, 1st Duke of Kingston-upon-Hull (left) and John Berkeley, 3rd Baron Berkeley of Stratton (right), Godfrey Kneller
male portrait paintings by godfrey knellercharles boyle, 2nd earl of burlington
Portrait of Charles Talbot, 1st Baron Talbot (1685-1737), John Vanderbank, circa 1737
gerhard bockmanjohn vanderbank
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DSC04882
self-published workcc-pd-mark
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DDSC04884
self-published workcc-pd-mark
Leda with cupid, Roman, 1st century AD, head from Antonia Minor, c. 35 AD, marble - Galleria Borghese - Rome, Italy - DSC04955
self-published workcc-pd-mark
Edward Lascelles, 1st Earl of Harewood, by Sir Joshua Reynolds, 1700s, oil on canvas - Cinnamon Drawing Room - Harewood House - West Yorkshire, England - DSC01921
self-published workcc-pd-mark
Female bust, inv. 2271, head from Claudian era, 1st century AD, bust from Hadrianic era, 2nd century AD - Braccio Nuovo, Museo Chiaramonti - Vatican Museums - DSC00942
self-published workcc-pd-mark
Defense.gov News Photo 120310-N-BL924-002 - Petty Officer 1st Class Charles Cisneros performs diagnostic checks on the mission systems of an MH-60R Sea Hawk helicopter assigned to Helicopter
mh-60s seahawkpeople
Doves, S 402, Roman, Tivoli, Hadian's Villa, 1st century AD, marble mosaic, after a work from the 2nd century BC attributed to Sosus of Pergamon - Musei Capitolini - Rome, Italy - DSC06099
self-published workcc-pd-mark
US Navy 061029-N-4515N-006 Explosive Ordnance Disposal Technician 1st Class Justin Mayo and Chief Explosive Ordnance Disposal Technician Jarrod Deines assigned to Explosive Ordnance Disposal Unit Eight (EOD-8), work as a team i
males with close quarters battle receiverfort story
US Navy 090701-N-9689V-005 Seabees assigned to Amphibious Construction Battalion (ACB) 1 and Naval Mobile Construction Battalion (NMCB) 1 renovate a building at Apia National Hospital
vehiclecar
US Navy 061212-N-9486C-001 Electronics Technician 1st Class Ryan Sweetser greets his wife after fast-attack submarine USS Buffalo (SSN 715) returned from a six-month deployment to the western Pacific
electronics techniciancelebrities
US Navy 060227-N-1194D-009 Seventh Fleet band member Musician 1st Class Frank Newton demonstrates how his saxophone keys operate to Aurora Sribuapun, headmaster of the Pattaya Redemptorist School for the Blind
thailandsax
US Navy 060519-N-4772B-077 Chief Engineer, Engineman 1st Class Hiep Nguyen surveys the deck of Landing Craft Utility One Six Five One (LCU-1651) as she departs the well deck of the amphibious dock landing ship USS Harpers Ferry
aboard uss harpers ferry (lsd-49)1970
US Navy 031213-N-5319A-013 Gunners Mate 1st Class Casey Rodgers assigned to Explosive Ordnance Disposal Mobile Unit Six (EODMU 6) is hoisted up into a SH-60 Seahawk
militaryarmy
US Navy 051205-N-9866B-068 U.S. Navy Culinary Specialist 1st Class Michael Elliot, the craftmaster of Landing Craft, Utility One Six Six Five (LCU-1665), assigned to Assault Craft Unit One (ACU-1), communicates with his crew in
speaking tubes1971
US Navy 090327-N-8467N-001 Lt. Scott Woods, left, administers the oath of enlistment to Machinist's Mate 1st Class Adam Bunker-Worley
front left views of the statue of libertyupshots of the statue of liberty
US Navy 090903-N-5366K-109 Culinary Specialist 1st Class Daniel Willis II, and Engineman 2nd Class Thomas Monahan, both assigned to the Ohio Navy Recruiting District, hands bags of beans to pack into boxes at the Mid-Ohio food
shoppingindoor
US Navy 090914-N-2600H-003 Aviation Machinist's Mate Airman Katherine Knipfer and Aviation Machinist's Mate 1st Class Jason Nieva, prepare to re-install the propeller assembly of an E-2C Hawkeye
aviation machinist's mateurban
US Navy 090611-N-5242D-221 Damage Controlman 1st Class James Harry, Damage Controlman Fireman Jason King and Djiboutian Navy Sublieutenant Moussa Hanfare help Djiboutian Navy Cpl. Abdoullauder Issa remove a fire-fighting ensemb
damage controlmandjiboutian navy
US Navy 090731-N-6138K-478 Damage Controlman 1st Class James Harry and Machinery Repairman 2nd Class James Porter, both assigned to the guided-missile destroyer USS Arleigh Burke (DDG 51), demonstrate the proper procedure for d
joint service lightweight integrated suit technologydamage controlman
US Navy 091127-N-4154B-135 Navy Diver 1st Class Daniel Muhlbach, assigned to Mobile Diving and Salvage Unit (MDSU) 2, comes out of the water during a search for the body of U.S. Army Sgt. Brandon Islip
watersea
US Navy 100208-N-5214S-185 Aviation Ordnanceman 1st Class Ivan McClean, from St. Thomas, Virgin Islands, assigned to the amphibious assault ship USS Bataan (LHD 5), cuts the center support pipe for a temporary shelter
operation unified responseaviation ordnanceman
US Navy 070711-N-1082Z-003 Aviation Machinist's Mate 1st Class Todd Thomas, assigned to the Tomcatters of Strike Fighter Squadron (VFA) 31, shows children from the Drug Education For Youth (DEFY) summer camp various aspects of
people at naval air station oceanaaviation machinist's mate
US Navy 070718-N-5928K-001 Deck edge operator Aviation Boatswain's Mate (Equipment) 1st Class Shawn Badley signals his hands are clear after launching an F-A-18F Super Hornet
aircraftvehicle
US Navy 080117-F-4089F-002 Builder 1st Class Jason Verneris greets children of the Bilate Charicho region in Ethiopia as they wait to attend the dedication of two new school buildings
military people and civilianswire net fences
US Navy 080117-N-7526R-060 Culinary Specialist 1st Class Garry Sacramento uses a calculator during the chief petty officer exam aboard the Nimitz-class nuclear-powered aircraft carrier USS Ronald Reagan (CVN 76)
people taking examinationspeople
US Navy 110830-N-NT881-076 Fire Control Technician 1st Class, Shane Adkins assists a Taft Elementary School student learn the principles of buoyanc
sitting boys2 males
US Navy 120207-N-NL541-447 An amphibious assault vehicle (AAV) assigned to 2nd Amphibious Assault Battalion, Delta Company, 1st Platoon, exits the
vehiclesea
US Navy 101218-N-6436W-037 Builder 1st Class Steven Maldonado and Gunnery Sgt. Javier Vega, both assigned to Naval Mobile Construction Battalion (N
military people on dutymales with helmets
US Navy 100607-N-1134L-132 Hospital Corpsman 1st Class Michael Faasen, assigned to Mobile Diving and Salvage Unit (MDSU) 2, and a Regional Security System diver look for damage during a pier inspection
underwaterwater
Billiard Room - Hearst Castle - DSC06362
1st floor north wing - billiards room (hearst castle)self-published work
US Navy 070823-N-9486C-075 Mineman 1st Class Ammie Faucett and Electrician's Mate 3rd Class Levi Martin of High Speed Vessel (HSV) 2 Swift paint a sign during a community relations project at the Hogar de Ninos San Ramon orphan
electrician's mateorphanage
US Navy 050920-N-1467R-015 Culinary Specialist 2nd Class Eric D. Oliver directs Culinary Specialist 1st Class Mathew Myers as he lifts pallet with supplies aboard the amphibious assault ship USS Bataan (LHD 5)
people at naval station mayportaboard uss bataan (lhd-5)
Rosslyn Erskine Wemyss, Baron Wester Wemyss, William Orpen, 1919
rosslyn wemyss, 1st baron wester wemyssportrait paintings by william orpen
Bust of Agrippina the Younger., Emil Wolff
ancient roman sculptures in the national museum in warsawbusts of agrippina minor
Defense.gov News Photo 100819-N-9769P-287 - Peruvian navy diver Falcon Bernol left and U.S. Navy Petty Officer 1st Class Shawn Cooley right with Company 2-6 Mobile Diving and Salvage Unit 2
united states navy mobile diving and salvage unit twowater
Defense.gov News Photo 111212-N-BT887-136 - U.S. Navy Petty Officer 1st Class Brian Adams checks for a clear deck aboard the aircraft carrier USS John C. Stennis CVN 74 in the Persian Gulf on
militaryaircraft
US Navy 050222-N-3019M-001 Culinary Specialist 1st Class Davidson Cervantes, assigned to the guided missile frigate USS Crommelin (FFG 37), helps a child read a book at Holomua Elementary School in Ewa Beach, Hawaii
culinary specialist (united states navy)people at pearl harbor
US Navy 051202-N-9851B-005 U.S. Navy Mineman 1st Class Kieth Pierson, assigned to Explosive Ordnance Disposal Mobile Unit Five (EODMU-5), Detachment Japan, has communication equipment attached to his protective bomb suit
minemanpeople
US Navy 071227-N-0193M-714 Operations Specialist Seaman Cody Thompson dives to block a soccer ball while playing with Construction Mechanic 1st Class Eric Dickinson and local children in Takoradi, Ghana
united states navy in sekondi-takoradiskateboarding
US Navy 080128-N-0193M-684 Sailors stationed aboard the high speed vessel (HSV) 2 Swift, in blue, and Togolese 1st Infantry Battalion, in red, battle it out for the ball in a friendly soccer game during the vessel's first port
association football in the united states navyaboard hsv-2 swift
US Navy 080128-N-0193M-422 Rear Adm. Anthony Kurta kicks out the first ball at a soccer game between members of the Togolese 1st Infantry Regiment and Sailors stationed aboard the high speed vessel (HSV) 2 Swift
association football in the united states navyaboard hsv-2 swift
US Navy 070706-O-0000X-002 Personnel Specialist 1st Class Kevin Armold, attached on board Naval Air Station Pensacola, is reenlisted by Army Maj. Shean Phelps on the main deck of the newly sunken aircraft carrier USS Oriskany
underwaterwater
US Navy 071130-N-0486G-006 During a tour of Naval Station Mayport's Helicopter Anti-Submarine Squadron (HSL) 40, Ed Begley Jr. watches as Air Warfare Systems Operator 1st class Glen Premo attaches a pair of night vision goggles
people at naval station mayportjr
US Navy 031213-N-5319A-009 Gunners Mate 1st Class Casey Rodgers assigned to Explosive Ordnance Disposal Mobile Unit Six (EODMU 6) attaches 20 pounds of explosives to a Dummy Mine during a mine counter measures exercise
waterwave
US Navy 070406-N-7130B-232 Resting on the wing of an F-A-18E Super Hornet Aviation Electrician's Mate 1st Class Daniel Castillo, from Avon Lake, Ohio, waits for the rest of his crew to arrive to begin routine maintenance on the
militaryvehicle
Pillar with guardian figure, China, Eastern Han dynasty, c. 1st century AD, earthenware - Portland Art Museum - Portland, Oregon - DSC08561
self-published workcc-pd-mark
Periander as a Greek scholar, Roman, head 130-140 AD, statue 1st century AD, base 140-150 AD from a sarcophagus with Nereids bearing the arms of Achilles, marble - Galleria Borghese - Rome, Italy - DDSC04883
self-published workcc-pd-mark
Bottle, attributed to southern Syria, 200-400 AD, free-blown glass, sheared rim - Huntington Museum of Art - DSC04838
3rd-century glassware in the united statesself-published work
Bixie (chimera), detail, attributed to Chu culture, Hunan or Hubei province, China, Western Han dynasty, 2nd-1st century BC, cast iron with silver inlay - Portland Art Museum - Portland, Oregon - DSC08555
self-published workcc-pd-mark
Statue of an emperor, once identified as Septimius Severus, Roman original with head and right arm restored by Paolo Naldini, 1st-3rd century AD, bronze - Cinquantenaire Museum - Brussels, Belgium - DSC09003
self-published workswords
Dotaku (bell-shaped bronze), excavated at 1-15 Kamo, Kawanishi-shi, Hyogo, Japan, Yayoi period, 1st-3rd century AD, bronze - Tokyo National Museum - Tokyo, Japan - DSC09156
self-published workcc-pd-mark
Dog figure, China, Eastern Han dynasty, 1st-3rd century AD, green glaze - Matsuoka Museum of Art - Tokyo, Japan - DSC07245
self-published workcc-pd-mark
US Navy 110423-N-SG869-047 Logistics Specialist Seaman Immanuel Carter and Logistics Specialist 1st Class Kristopher Forest hook a load onto an SH
militaryvehicle
US Navy 100820-N-8959T-207 Explosive Ordnance Disposal Technician 1st Class Gregory Pruett climbs a ladder to an SH-60F Sea Hawk helicopter during a mine countermeasures training evolution
helicopters in flightladder
US Navy 080717-N-9818V-490 he wife of Explosive Ordnance Disposal 1st Class Tyrone Logan, 2008 U.S. Fleet Forces Command Sea Sailor of the Year, pins chief's anchors onto his uniform
united states navy images from washingtond.c.,
US Navy 080807-N-7029R-065 Aerographer's Mate 1st Class Jeffrey Jackson embraces his wife and daughter after departing the aircraft carrier USS Kitty Hawk (CV 63) at Naval Air Station North Island
aboard uss kitty hawk (cv-63)aerographer's mate
US Navy 090401-N-5366K-005 Special Warfare Operator 1st Class (SEAL) Aaron Darakjy, assigned to the U.S. Navy Parachute Team, show a student how to pack a parachute at Granada Hills Charter High School
los angeleslawn
US Navy 081220-N-6724S-011 Aviation Ordnanceman 1st Class David Steele, assigned to Pre-Commissioning Unit George H.W. Bush (CVN 77), works on his Victory Lap Late Model Series race car in his garage
modified carsvirginia
US Navy 090130-N-5253W-001 Aviation Boatswain's Mate (Handling) 1st Class Darrio Davis, from Baltimore, directs the pilot of an AV-8B Harrier II aircraft
militaryvehicle
US Navy 040920-N-3019M-006 Boatswain's Mate 1st Class Jesse Rodriguez cooks hamburgers, hot dogs and chicken for family members
grillfood
US Navy 041016-N-9693M-004 U.S. Naval Academy Midshipman 1st Class Kyle Eckel is tackled by Notre Dame line backer Brandon Hoyte at Giants Stadium in Rutherford, N.J
new jerseysport
US Navy 060606-N-9851B-015 1st Sgt. Louis Goh and Personnel Specialist 2nd Class Tristan Delatorre, members of a combined U.S. and RSN visit, board, search and seizure (VBSS) team, compare equipment on the deck of amphibious do
personnel specialist (united states navy)aboard uss tortuga (lsd-46)
US Navy 060503-N-8269F-002 Legalman 1st Class Malinda Schreffler assigned to Commander Carrier Strike group Two (CCSG-2) work alongside fellow shipmates assigned to the amphibious transport dock ship USS Shreveport (LPD 12)
united states navy images from port evergladesuss shreveport (lpd-12)
US Navy 040329-N-3228G-003 Master-at-Arms Seaman Ray Cowan and Master-at-Arms 1st Class Vicki Guist, both assigned to Naval Station Pearl Harbor Security, patrol the West Loch area of Pearl Harbor
people at pearl harbormaster-at-arms
US Navy 051202-N-9851B-002 U.S. Navy Mineman 1st Class Kieth Pierson, assigned to Explosive Ordnance Disposal Mobile Unit Five (EODMU-5), Detachment Japan, directs the actions of a Remote Ordnance Neutralization System
minemanarmy
US Navy 050908-N-6477M-271 Hull Technician 1st Class Chance D. Barker casts off a line from the pier as the Nimitz-class aircraft carrier USS Abraham Lincoln (CVN 72) prepares for departure from Naval Station Everett, Wash
waterboat
US Navy 110218-N-8607R-127 Marines assigned to the Force Reconnaissance Platoon of the 31st Marine Expeditionary Unit (31st MEU) fast rope
aircraftaviation
US Navy 101111-N-3154P-236 Naval Air Crewman 1st Class Joseph Ward, assigned to Helicopter Sea Combat Squadron (HSC) 22, examines the tail rotor of
militaryvehicle
US Navy 070202-N-8110K-047 Information Systems Technician 1st Class Tanya Whitner and fellow Sailors assigned to guided missile cruiser USS Mahan (DDG 72) serve lunch to homeless veterans at the New England Shelter for Homeless
veterans of the united statesaboard uss mahan (ddg-72)
US Navy 081129-N-2456S-026 Aviation Structural Mechanic 1st Class Todd Theobalt, assigned to HS-3, applies paint thinner to a float bag prior to painting an SH-60H Sea Hawk in the hangar bay aboard the aircraft carrier USS Theo
uss theodore roosevelt (cvn-71) hangar deckpeople
US Navy 090424-N-9928E-067 Gunner's Mate 1st Class Eddieesther Trinidad, left, from San Diego, Calif., helps Gunner's Mate 3rd Class Casey Gil, from Newaygo, Mich., load a .50-caliber machine gun
browning m2 in united states navy servicegunner's mate
US Navy 090219-N-9552I-030 Naval Aircrewmen 1st Class Troy Rudisill and David Williams conduct pre-flight checks in the cockpit of a Gulfstream C-20A-G III
military aviators in cockpitsgulfstream iii
US Navy 070605-N-4515N-069 Special Warfare Boat Operator 1st Class Nicholas Powell navigates a Mark Five Special Operations Craft while Chief Special Warfare Boat Operator Dwayne Van Tassel explains some of the controls to Secr
mark v special operations craftvirginia
US Navy 070702-N-5555T-009 U.S. Army Soldiers from 2nd Platoon, Bravo Company, 1st Battalion, 30th Infantry Regiment, receive a briefing about a high-value target in the Arab Jabour region of Iraq
30th infantry regiment (united states)males with m4 carbine
US Navy 070808-N-3093M-001 Navy Diver 1st Class Josuha Harsh Mobile Diving and Salvage Unit (MDSU) 2 from Naval Amphibious Base Little Creek, Va., gives the okay sign after having his MK-21 diving helmet remove
i-35w mississippi river bridge collapse recoveryunited states navy divers
US Navy 080604-N-8848T-071 Rear Adm. Jon W. Bayless, right, the commander of Navy Region Midwest, reenlists Navy Counselor 1st Class Sean Nagle at U.S. Cellular Field
reenlistmentjr
US Navy 080617-N-3857R-019 Special warfare combatant-craft (SWCC) crewmen assigned to Special Boat Team 22 traverse the waterways of the Stennis Space Center
vehiclewater
US Navy 091006-N-1688B-184 Interior Communications Electrician 1st Class Ryan Ratts, the flight deck safety officer aboard the guided missile destroyer USS Cole (DDG 67), observes a British civilian helicopter land during fligh
interior communications electricianaboard uss cole (ddg-67)
US Navy 110423-N-GL340-029 Logistics Specialist Seaman Immanuel Carter and Logistics Specialist 1st Class Kristopher Forest run to clear an SH-60H
logistic specialistnavy
US Navy 091029-N-6220J-016 Aviation Boatswain's Mate (Fuels) 1st Class Ulric Carter reviews a young girl's reading homework at the Finnigan Park Boys and Girls Club
architecturefuel
US Navy 091104-N-0807W-320 Engineman 1st Class Donandrew R. Paredes, assigned to Assault Craft Unit (ACU) 5 embarked aboard the amphibious dock landing ship USS Harpers Ferry (LSD 49)
landing craftair cushion
US Navy 090714-A-1839I-038 Hospital Corpsman 1st Class Elizabeth Gracie demonstrates how to apply an arm splint during a first aid class given to Brazilian Navy sailors aboard the amphibious dock landing ship USS Oak Hill (LSD
aboard uss oak hill (lsd-51)first aid training
Bottle, attributed to southern Syria, 200-300 AD, free-blown glass, waisted neck, rolled and flared rim - Huntington Museum of Art - DSC04833
3rd-century glassware in the united statesself-published work
Nationale oldtimerdag Zandvoort 2010, 1967 CHEVROLET CHEVELLE MALIBU, AM-56-93 pic1
vehiclecar
Female banquet chef, Sichuan province, China, Eastern Han dynasty, 1st-2nd century AD, earthenware - Portland Art Museum - Portland, Oregon - DSC08540
self-published workcc-pd-mark
Female banquet chef, Sichuan province, China, Eastern Han dynasty, 1st-2nd century AD, earthenware - Portland Art Museum - Portland, Oregon - DSC08539
self-published workcc-pd-mark
8601 - 8700 of 19,364 Next page
/ 194